PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01556g01032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 511aa    MW: 55788.4 Da    PI: 9.2558
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01556g01032.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.12.2e-42151226277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv+gC +dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  Peinf101Scf01556g01032.1 151 CQVQGCGKDLSSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 226
                               **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.624148225IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.2E-33148212IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-39150229IPR004333Transcription factor, SBP-box
PfamPF031101.7E-32151224IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MESWSYVSGG KGFISEESAN VNDGRVKNGV MGWESKTQSS YGSTVMCSSQ EVSDNQGFPE  60
LGSQNLMRKV MFNDPSRDNL TSKLGSGRIS SSSVVESNSR DSSLFDLKLG RFPDHIDAKV  120
FKSPKFMPNF NSAESIVPAK RLRAGGLSSF CQVQGCGKDL SSSKDYHKRH KVCEVHSKTA  180
KVIVNGIEQR FCQQCSRFHL LAEFDDGKRS CRKRLAGHNE RRRKPHTGTR FRGTSFATSS  240
FICQDILGGR ILHQPKYEMN DWYKNVKVED GVDYSPQLTM PFTNGQLQPK SVFTSYHAKK  300
QCPPLHNEGL PSLTGRKINE STNTSPHEMG GSDFVSPSLF RTTSIGTEVL HVLDTSSNIQ  360
GLSGISSSSN ALSLLSSQSQ DSSNHSTIIP VAHPLIPPSS NSQYNVTQVS KKVIGVSPQA  420
SASSLSNTFN PSGVNSAEGG LEQILIPSNT GGINGVIQGS NCVNTKNQLS CEDGPTINLF  480
QLSSQLQRVE HQRLSMQMKQ DNSAFPGLRI T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-301502241084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019230968.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A2K9ZXI20.0A0A2K9ZXI2_PETHY; Squamosa promoter binding-like protein 6d
STRINGXP_009758722.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-44SBP family protein