PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01533g05063.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ARF
Protein Properties Length: 671aa    MW: 74867.7 Da    PI: 7.5444
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01533g05063.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.3e-23111211198
                               EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                               f+kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g  W +k+i+r++++r++lt+GW+ Fv++++L +gD++
  Peinf101Scf01533g05063.1 111 FCKVLTASDTSTHGGFSVLRKHANEClpqldMSQQTPTQELIAKDLHGIDWHFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDSF 195
                               99****************************9555556679********************************************* PP

                               EEEE-SSSEE..EEEEE- CS
                        B3  81 vFkldgrsefelvvkvfr 98 
                               vF ++   ++el+v+v+r
  Peinf101Scf01533g05063.1 196 VFLRS--GNGELRVGVRR 211
                               ***54..68888***998 PP

2Auxin_resp100.32.5e-33237316183
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+k+k+svGmRfkm+fe+e+ +err++Gt+vgv dl++ +W++S WrsLk
  Peinf101Scf01533g05063.1 237 ASHAVTTQTLFVVYYKPRT--SQFIIGLSKYLEAVKHKYSVGMRFKMRFEGEENPERRFTGTIVGVDDLSS-QWKDSTWRSLK 316
                               689***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.4E-42102226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.62E-40105240IPR015300DNA-binding pseudobarrel domain
CDDcd100171.34E-19110211No hitNo description
PfamPF023621.2E-21111211IPR003340B3 DNA binding domain
PROSITE profilePS5086312.21111213IPR003340B3 DNA binding domain
SMARTSM010194.9E-20111213IPR003340B3 DNA binding domain
PfamPF065072.0E-31237316IPR010525Auxin response factor
PfamPF023092.0E-7558603IPR033389AUX/IAA domain
SuperFamilySSF542771.08E-11561643No hitNo description
PROSITE profilePS5174523.582567648IPR000270PB1 domain
PfamPF023092.2E-5613654IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MANNGCYQFQ QQSNFSAEVS GKDDLYQELW KLCAGPLVDV PKEGEKVYYF PQGHMEQLEA  60
SINQELNHKI PSFNLQPKIL CRVIHIQLKQ TEPTSPDPCP PESPRPKVQS FCKVLTASDT  120
STHGGFSVLR KHANECLPQL DMSQQTPTQE LIAKDLHGID WHFKHIFRGQ PRRHLLTTGW  180
STFVSSKRLV AGDSFVFLRS GNGELRVGVR RLARQQSSMP SSVISSQSMH LGVLATASHA  240
VTTQTLFVVY YKPRTSQFII GLSKYLEAVK HKYSVGMRFK MRFEGEENPE RRFTGTIVGV  300
DDLSSQWKDS TWRSLKVQWD EPASISRPDR VSPWEIEPFV ASIPNPLVQP MTGKNKRHRP  360
YSETKISEPA SSTASAVWNP SLDSPQFNTT LERQKSDCPF SLPATQNDTS STGIKRSSSK  420
CTFTSHIEGG WRLPQLNTSS NMLVDETEDI KSASAWSGFP SVSTSQFGKG TNQPIPGLTD  480
EKKSDTNTTC RLFGIDLKST SISTTEALLP KPAKISDVAA ERAPPSTVPA GDSDQSSDLS  540
IDIKDQKQGH LQLPLKEAQS KQSFSTRSCT KVQMQGIAVG RAVDLTALKG YDELIKELEE  600
MFEIQGELHP RNKWEIVFTD DEGDMMLMGD HPWLEFCNVV RRIFICSSQD MKKLSAVNKP  660
LSCADSEVTA L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1602333917355Auxin response factor 1
4ldw_A1e-1602333917355Auxin response factor 1
4ldw_B1e-1602333917355Auxin response factor 1
4ldx_A1e-1602333917355Auxin response factor 1
4ldx_B1e-1602333917355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592767.10.0PREDICTED: auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A1U7V9N80.0A0A1U7V9N8_NICSY; Auxin response factor
STRINGXP_009592767.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9