PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01482g15029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 230aa    MW: 27107.5 Da    PI: 4.7892
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01482g15029.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41.1e-173080656
                              S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                              +ft+eq++ Le +F+++ ++  +++ +LA+ +gL+ rqV +WFqN+Ra++k
  Peinf101Scf01482g15029.1 30 RFTDEQVKLLEFMFNQETKLEPRKKLQLARDIGLQPRQVAIWFQNKRARWK 80
                              8*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.26E-172084IPR009057Homeodomain-like
PROSITE profilePS5007116.4872282IPR001356Homeobox domain
SMARTSM003893.6E-142586IPR001356Homeobox domain
CDDcd000862.25E-132983No hitNo description
Gene3DG3DSA:1.10.10.603.0E-192989IPR009057Homeodomain-like
PfamPF000463.8E-152980IPR001356Homeobox domain
PRINTSPR000314.1E-55362IPR000047Helix-turn-helix motif
PROSITE patternPS0002705780IPR017970Homeobox, conserved site
PRINTSPR000314.1E-56278IPR000047Helix-turn-helix motif
PfamPF021839.0E-1582122IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEPEECPALE KCETPKSKKA LKKKSENVRR FTDEQVKLLE FMFNQETKLE PRKKLQLARD  60
IGLQPRQVAI WFQNKRARWK SKQLEHDYTI LKANFDKLNM QFQTLKTEKE RLLIQVETLN  120
DQIENKLVRG SRSQESKDNE LYTSSENGGT DLELKDSPGC SNARIDYMMV KEEDDDTVEE  180
TNKYLKPKEE AEFWNLEELE DNSLESPEHW SVGLGSFFSQ PCDNSKLWDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611805.11e-120PREDICTED: homeobox-leucine zipper protein ATHB-7-like
RefseqXP_016442723.11e-120PREDICTED: homeobox-leucine zipper protein ATHB-7-like
TrEMBLQ6UK171e-94Q6UK17_CAPAN; HD-ZIP
STRINGPGSC0003DMT4000476224e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.18e-40homeobox 7