PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01482g13028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRF
Protein Properties Length: 424aa    MW: 46982.7 Da    PI: 6.645
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01482g13028.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC757.8e-2481123244
                       WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  Peinf101Scf01482g13028.1  81 LEPGRCKRTDGKKWRCSRDVAPFQKYCERHMHRGRPRSRKHVE 123
                               69***************************************98 PP

2QLQ514.3e-182153234
                       QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34
                              +FT+aQ+ +L++Q+++yKy+++  PvP++Llq+
  Peinf101Scf01482g13028.1 21 PFTWAQWKELERQAMIYKYMVSAIPVPQDLLQF 53
                              8******************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-82056IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.2E-132152IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.3162156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.00580124IPR014977WRC domain
PfamPF088798.7E-2082123IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MNVLFVCGNF AGGMTTALGL PFTWAQWKEL ERQAMIYKYM VSAIPVPQDL LQFCINSSGA  60
SHTTLSSGLV QGQRYTNVRD LEPGRCKRTD GKKWRCSRDV APFQKYCERH MHRGRPRSRK  120
HVEVHANENN KKTRIHPEST PMAVPKPPTP TGQTKSTSSS TQPIRSTFQQ MQGPLFFNGK  180
MRNSGWTMER ELVAKADVGQ HLMDSNTDFS ADVKVHPDLQ HGYKVEALNL LACRGLERTE  240
DVSIKHNGEF NFMINPELVK QSVEEAPRDL INAWSNDEVY YNSNNENMEA SLWPSQGNIS  300
PSSLTLSMAM AAGDALDADM GLESNVAMNG YRNESWENYW VPFASGGPLA EVLHPNTSSI  360
QGENPATSYI SNDDSISPAA TTVSSPSGVL QKTMFSHSDG SVCNSPILAP PTTNTSETVP  420
FQWL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754423e-50HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597556.10.0PREDICTED: growth-regulating factor 7-like isoform X3
RefseqXP_009597555.10.0PREDICTED: growth-regulating factor 7-like isoform X2
RefseqXP_009597554.10.0PREDICTED: growth-regulating factor 7-like isoform X1
TrEMBLM0ZUG20.0M0ZUG2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000083520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-35growth-regulating factor 7