PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01470g01004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 218aa    MW: 24965.9 Da    PI: 7.2868
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01470g01004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1001.7e-313589358
               ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                              k +YkeClkNhA+ +G+havDGCgEfm++ geegt +++kCaAC+CHRnFHR++ +
  Peinf101Scf01470g01004.1 35 KPKYKECLKNHAVGIGSHAVDGCGEFMAA-GEEGTLESFKCAACNCHRNFHRKHIV 89
                              679*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-221886IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.0E-283787IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-283787IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.13887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.69E-17128201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-29130201IPR009057Homeodomain-like
TIGRFAMsTIGR015651.0E-24140196IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDFEDKEIHD GNSGRPQTPP SPGELDTEAP LTMRKPKYKE CLKNHAVGIG SHAVDGCGEF  60
MAAGEEGTLE SFKCAACNCH RNFHRKHIVE ITTTYPLLTH HPYNHFPPPP YHHHHHHQQQ  120
LTPLALPSTS EQNDMSNGGK KRFRTKFSQE QKMKMQELAE KIGWRIQRQD DSIVQQFCDE  180
NGVKRNVFKV WMHNNKHTLG KNLSLEPSNL NEAAEQEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-231401981775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619186.13e-76PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH57e-66ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1C6692e-71M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606236e-71(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-54homeobox protein 22