PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01458g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 169aa    MW: 18964.9 Da    PI: 9.064
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01458g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.48e-29961557
               ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                               Y+eCl+NhAaslG++a+DGCgEf+ +++++  +++l+CaACgCHRnFHR+ +
  Peinf101Scf01458g00005.1  9 LYRECLRNHAASLGSYATDGCGEFTLDDTNSPGTNTLHCAACGCHRNFHRKVT 61
                              7*************************988888899****************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.6E-24961IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.0E-241059IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-171059IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.0781060IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.609.2E-2885153IPR009057Homeodomain-like
SuperFamilySSF466896.39E-1687151IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-2693151IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MQGDKPNDLY RECLRNHAAS LGSYATDGCG EFTLDDTNSP GTNTLHCAAC GCHRNFHRKV  60
TYGGTNSYSN NSNRDDREII AAAELTDSPR SSKKRFRTKF TTDQKGKMLA FAEKLGWTLQ  120
RKDQENETER FCREIGVSRK VFKVWMHNHK NNSSSVSSTT GNNASSLTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-20941551878ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068151.13e-97PREDICTED: zinc-finger homeodomain protein 9-like isoform X1
SwissprotA2XLF41e-42ZHD11_ORYSI; Zinc-finger homeodomain protein 11
SwissprotQ10DV51e-42ZHD11_ORYSJ; Zinc-finger homeodomain protein 11
TrEMBLM1D7H04e-96M1D7H0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000839931e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA118652023
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.23e-36homeobox protein 31