PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01325g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 235aa    MW: 26408.7 Da    PI: 8.5669
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01325g00008.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.81.4e-2990142356
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                               +v+Y eClkNhAa++Gg+a DGC+Efmps geegt +alkC+AC CHRnFHR+ 
  Peinf101Scf01325g00008.1  90 GVKYMECLKNHAAAIGGNARDGCCEFMPS-GEEGTLEALKCSACHCHRNFHRKL 142
                               689*************************9.999*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.1E-2691141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.5E-2792141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2092141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.22393142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.3E-19182235IPR009057Homeodomain-like
SuperFamilySSF466899.56E-12182235IPR009057Homeodomain-like
TIGRFAMsTIGR015655.6E-20186235IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MSNISTQVVA LNNNNNNNNN NKSSNIEDGN YPNENGSQAM EVHDQERVIH EEPLSEGNSK  60
KYMVMVRNSS TPFGYNKAGG NNDNIIDEGG VKYMECLKNH AAAIGGNARD GCCEFMPSGE  120
EGTLEALKCS ACHCHRNFHR KLLQALEQRK ISYKNGIITS PTSDSDDGKE GAGFMALKRP  180
CQQAIKKRFR TKFTREQKEK MFNFAEKAGW KIQKLDDSVI HQFCQELGIK RRVLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-171872351866ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016510094.12e-57PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_009607017.12e-57PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotO647224e-51ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLM0RH781e-58M0RH78_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P11020_0013e-58(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1837924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.16e-52homeobox protein 21