PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01318g05011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YA
Protein Properties Length: 190aa    MW: 21028.4 Da    PI: 9.4432
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01318g05011.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.87.5e-33103159158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep++VNaKQy++Il+RRq+Rak+e+e+kl  k+rkpylheSRh hAl+R+Rg+gGrF
  Peinf101Scf01318g05011.1 103 EEPVFVNAKQYHGILRRRQSRAKAESENKL-LKARKPYLHESRHLHALKRARGCGGRF 159
                               69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-35101162IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.576102162IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-27104159IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.8E-23105127IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860107127IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.8E-23136159IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
SSENEQPQKQ SEAQSPSSST VAGLSFPGTL TPNTHYMMPS QLGNANAMAH TAYPYPDPYY  60
RSIFAPYEAQ PYPAQPYPAQ SMVHLQLMGI QQAGVPLPSD NVEEPVFVNA KQYHGILRRR  120
QSRAKAESEN KLLKARKPYL HESRHLHALK RARGCGGRFQ KKTGESGDNS QANLNTDSNK  180
IEITSSENVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-21102159158NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-41HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006363651.11e-112PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_006363652.11e-112PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP13e-59NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLM1AUU31e-112M1AUU3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000308131e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66502333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.23e-56nuclear factor Y, subunit A7