PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01300g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 178aa    MW: 19165.8 Da    PI: 7.4335
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01300g00003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.88.1e-31115167356
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                               +v+Y eClkNhAa++Gg+a+DGC+Efmps geegt +alkC+AC CHRnFHR+ 
  Peinf101Scf01300g00003.1 115 GVKYMECLKNHAAAIGGNAIDGCCEFMPS-GEEGTLEALKCSACHCHRNFHRKL 167
                               689*************************9.999*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047709.3E-28116166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-20117166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.4E-28117166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.926118167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MRQWRGGGSM LAVIMTSRNV KDKVSTSMPT SNNSNSMLEL SWIAILGGPE ALDLHGRRIR  60
VNYAIEKRRD GFEGFGGYAT INYGCGGGVY SGGTSFHGEG DKAGGNNDNI IDEGGVKYME  120
CLKNHAAAIG GNAIDGCCEF MPSGEEGTLE ALKCSACHCH RNFHRKLLQV LLIYSILV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088426.11e-25PREDICTED: zinc-finger homeodomain protein 3-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1837924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-26homeobox protein 22