PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01278g07017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 487aa    MW: 54298.4 Da    PI: 7.4715
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01278g07017.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.68.3e-24212263152
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEET CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhel 52 
                               +Cqv+gC++dls+ k+yh+rhkvC+ hsk++ v+v+g+eqrfCqqCsrf ++
  Peinf101Scf01278g07017.1 212 VCQVHGCSKDLSSSKDYHKRHKVCDEHSKTAIVVVNGIEQRFCQQCSRFLDM 263
                               6************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-24207261IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.255210287IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.1E-22211263IPR004333Transcription factor, SBP-box
PfamPF031102.9E-18213263IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MEPLSYALEG RGFMFSDNVE LPVDSLARSR NSVKEWNLNP FCDVDKSICG TSQEINESTE  60
FLDSGIADIL KKSAGRTPRS MFSFEPIHGE MELGAMFNHS GTKSNTPMSS QIDLKLEELT  120
DYGDARTSQS SKESSVLSSP ERPLPTGKAQ TKSSHSRFPT SQGHDQREDE SIVHREVKSN  180
QSLKRNSALS SVNSSVQGKK LRTTNLHSEV PVCQVHGCSK DLSSSKDYHK RHKVCDEHSK  240
TAIVVVNGIE QRFCQQCSRF LDMTSQRRVP FLFPEILPGS FFYQENNDSK HLKSEHKPFC  300
ISELAMSVTS GQSSAKNIKH QYGTRKHDRS KVHFGATLSV QEFSAGQNSS CALSLLSAHS  360
QNLLHNSTDI SPTPPWMVKG NNYSYIKGDH HNKSPKSTTP VELYSSEVVE QDGVLQVPDS  420
EAVSFEIQRN RHDQKSNSIN SKNFLSPGCA PTMDLVQLSS HLQRVEQQKN SVQVKQENDI  480
FCSFTSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A6e-16213260653squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732941e-163LC073294.1 Nicotiana tabacum NtabSPL6-6 mRNA for squamosa promoter binding protein NtabSPL6-6, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074864.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2K9ZXJ20.0A0A2K9ZXJ2_PETHY; Squamosa promoter binding-like protein 6a
STRINGSolyc05g012040.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-28SBP family protein