PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01241g15008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 331aa    MW: 37179.2 Da    PI: 4.6233
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01241g15008.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-19100153356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k++++t+eq++ Le+ Fe ++++  +++ +LAk lgL+ rq+ +WFqNrRa++k
  Peinf101Scf01241g15008.1 100 KKRRLTAEQVQFLEKSFEVENKLEPDRKVQLAKDLGLQPRQIAIWFQNRRARWK 153
                               56789************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.91E-1989156IPR009057Homeodomain-like
PROSITE profilePS5007117.42795155IPR001356Homeobox domain
SMARTSM003893.5E-1998159IPR001356Homeobox domain
CDDcd000861.60E-17100156No hitNo description
PfamPF000461.9E-16100153IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.9E-20101162IPR009057Homeodomain-like
PRINTSPR000311.2E-5126135IPR000047Helix-turn-helix motif
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5135151IPR000047Helix-turn-helix motif
PfamPF021831.1E-12155196IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAAGRGLFYS DAAGGAGFNI TLFQKQRILS SSSSSCVTTD AVGSLLVPGC SPPFLASGSM  60
VSFGGVNGGK KSDSTFFQSF DQEENEIDQD LEEYLHQPEK KRRLTAEQVQ FLEKSFEVEN  120
KLEPDRKVQL AKDLGLQPRQ IAIWFQNRRA RWKTKSLETD YEALRNKYDK MKADYSNVLR  180
EKEDLRAEVV RLTNKLLLKD KEKGELDTSD VKKPSDVSPK ENMVVPTLED EVSKVSASVL  240
KQQDDFNSAK SDVLNSESLH YTDGVQSSIL EQGDSSNVFE HDQSDLSQDE EENFSKNLLA  300
KVEHDHCPMT SSNLSFFGFS VEDQGFGFWS F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604802.11e-168PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLA0A314KNV71e-146A0A314KNV7_NICAT; Homeobox-leucine zipper protein hat5
STRINGXP_009604802.11e-168(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-44homeobox 1