PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01208g05010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ARF
Protein Properties Length: 685aa    MW: 76300 Da    PI: 7.0038
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01208g05010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.13.4e-23111211198
                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                               f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD
  Peinf101Scf01208g05010.1 111 FCKILTASDTSTHGGFSVLRKHANEClpqldmtQ--ATPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGD 193
                               99**************************999543..445568******************************************* PP

                               EEEEEE-SSSEE..EEEEE- CS
                        B3  79 fvvFkldgrsefelvvkvfr 98 
                                +vF   + +++el+v+v+r
  Peinf101Scf01208g05010.1 194 AFVFL--RGDNGELRVGVRR 211
                               *****..3489999****98 PP

2Auxin_resp101.11.4e-33237316183
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vg  d+++ +W++SkWrsLk
  Peinf101Scf01208g05010.1 237 ASHAITTQTRFVVYYKPRT--SQFIIGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGAGDISS-QWSESKWRSLK 316
                               789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.46E-40101240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-39103226IPR015300DNA-binding pseudobarrel domain
CDDcd100173.98E-20110211No hitNo description
PfamPF023624.3E-21111211IPR003340B3 DNA binding domain
PROSITE profilePS5086312.041111213IPR003340B3 DNA binding domain
SMARTSM010191.3E-20111213IPR003340B3 DNA binding domain
PfamPF065072.2E-31237316IPR010525Auxin response factor
PfamPF023093.5E-6558606IPR033389AUX/IAA domain
SuperFamilySSF542774.76E-13567646No hitNo description
PROSITE profilePS5174526.938570662IPR000270PB1 domain
PfamPF023091.3E-7616660IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MGSDDLYTEL WKACAGPLVD VPRAGERAYY FPQGHIEQLE ASTNQALNQQ IPQFNLPSKI  60
LCRVVHVQLL AETETDEVYA QITLHPEAEQ EEPSSPDPCL PDQPKQSVQS FCKILTASDT  120
STHGGFSVLR KHANECLPQL DMTQATPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW  180
STFVTSKRLV AGDAFVFLRG DNGELRVGVR RLARQQSAMP QSVISSQSMH LGVLATASHA  240
ITTQTRFVVY YKPRTSQFII GLNKYLEAVS HGFSVGMRFR MRFEGEDSPE RRFTGTIVGA  300
GDISSQWSES KWRSLKIQWD EPASILRPDR VSPWEIEPFV APTSVDVAQP GIKSKRPRPL  360
ELPHTETAAA SAASSFWYPG SGPTLKVSHL GSVAEVQSHD NQLFWSSKQN SSLSNSMSNI  420
SCRTHLSGAW QHNMLANGSV NLFRDSIEDN KQLTARSAIL DYGSPMSSRA SNGLLLEQVV  480
RGNKREISSA CRLFGIDLRT NSNNATTREK EMLGPNVTSN CTNNAPTGPD SSEVDKDRSV  540
EHLNPSEEKK QVQLEALAKD THRQGLTSSR TRTKVQMQGV RVGRAVDLTA LSGYNDLISE  600
LEKIFDIKGE LCPRNKWEVV YTDDEGDMML VGDDPWPEFC KMVRRIFIYS SEEVKKMSPR  660
CKLPILSLEG EGTMPSVDSG LKSEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-173333916355Auxin response factor 1
4ldw_A1e-173333916355Auxin response factor 1
4ldw_B1e-173333916355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354358KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331201e-117AC233120.6 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence.
GenBankHG9754401e-117HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755131e-117HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339723.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0V0ISA10.0A0A0V0ISA1_SOLCH; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]