PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00997g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRF
Protein Properties Length: 365aa    MW: 41470 Da    PI: 9.0342
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00997g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.23.9e-2578121144
                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                               d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  Peinf101Scf00997g00004.1  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 121
                               79***************************************997 PP

2QLQ60.64.3e-211145236
                       QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                              +FTa+Q+q+L++Q+l+yKy+++++PvPp+Ll  i+
  Peinf101Scf00997g00004.1 11 PFTASQWQELEHQALIYKYMVSGMPVPPDLLYTIR 45
                              9*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-111046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.2341146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-161144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32578122IPR014977WRC domain
PfamPF088793.4E-2179121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MMSTTARSRY PFTASQWQEL EHQALIYKYM VSGMPVPPDL LYTIRRSLDS ALSSKLILHQ  60
PHHIGWNCFQ MGFGKKIDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGRNRSRKPV  120
EVMTLANNTT TNTSTRPVVT TNTPPTAIPI SSITKNTNNN PSPCSPTSFP NYMTSSADQS  180
HQYPFLYPHS SSSRPPGSGI SLSSSTHDHT TKYLFESGPY SRNSYGDGMK EEVDEHVFFS  240
EASVGTMRSS TSSVEDTTWQ LSPLTMGSPM KQRTYSLSQN STAHSSNYLQ LQSLNESSRQ  300
HIDNAEDHQQ QPKKVMHHFF DEWPPKDNKD SWLDSEDKFS GHSKTQLSIS IPNSSQDFFI  360
HRNGK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAPTransfer from AT2G06200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755193e-65HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
GenBankHG9754463e-65HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016449439.11e-170PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLK4CE321e-145K4CE32_SOLLC; Uncharacterized protein
STRINGSolyc07g041640.2.11e-145(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-61growth-regulating factor 5