PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00914g03017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 304aa    MW: 34162.8 Da    PI: 7.9614
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00914g03017.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.5e-3275132260
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                               + vrYkeClkNhAa++Gg+a+DGCgEfmps geegt +al C+AC+CHRnFHR+e e e
  Peinf101Scf00914g03017.1  75 KMVRYKECLKNHAATMGGNATDGCGEFMPS-GEEGTLEALICSACNCHRNFHRKEIEGE 132
                               679**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.9E-2977129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2577132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.8E-3178129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.27879128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.3E-30222291IPR009057Homeodomain-like
SuperFamilySSF466891.02E-18223290IPR009057Homeodomain-like
TIGRFAMsTIGR015654.7E-27229285IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MELPNQEDEM PLPINSTYVG GVHQHGHGHI IHHDPTPPNS TTNHIIPSSV APPSMNGPPI  60
DAAPVASDHH LPYKKMVRYK ECLKNHAATM GGNATDGCGE FMPSGEEGTL EALICSACNC  120
HRNFHRKEIE GEQQLLQQQS LPSPCDYYHL NRVGKKVYLG SHHHKSLLGP EPFGTIIPSR  180
PAPHQMIMSY NMGSLPNSES EEHEDGHANG GVMSMAMARP IHHHHQNVKK RFRTKFTQEQ  240
KEKMLNFAEK VGWKIQKQEE AVVQQFCQEV GVKRRVLKVW MHNNKHNLAK KNNDSNNIIP  300
ISQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-252302871875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755132e-59HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
GenBankHG9754402e-59HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613099.11e-163PREDICTED: zinc-finger homeodomain protein 4
RefseqXP_016501840.11e-163PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_016501841.11e-163PREDICTED: zinc-finger homeodomain protein 4-like
TrEMBLK4B1M41e-149K4B1M4_SOLLC; Uncharacterized protein
STRINGSolyc01g102980.2.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-69homeobox protein 31