PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00889g05023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 466aa    MW: 50838.8 Da    PI: 8.4833
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00889g05023.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.81e-40175252178
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               +CqvegC+ dls+akey+r+hkvC+ h+k+p+v+v+g+ +rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  Peinf101Scf00889g05023.1 175 RCQVEGCNLDLSSAKEYYRKHKVCDSHAKCPKVIVAGVARRFCQQCSRFHSLSEFDEKKRSCRRRLSDHNARRRKPQQ 252
                               6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-31169237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.855173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37174255IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MEWNVKWDWG NLVMFDSNVS KSPKELQLTD WGVEEEGELD AGSFNLSSGG SGTGGYGSDV  60
GRGSSIKSSM SASTDSSPRE SLKASNFAFE AFDGSPEDLS KKMGPCRAEL FRNSPAMEAS  120
VGSVEPLIGL KLGKRTCEAI MGGSSSKVSS FPQNPISSAA TKKTKSSCQN AAMSRCQVEG  180
CNLDLSSAKE YYRKHKVCDS HAKCPKVIVA GVARRFCQQC SRFHSLSEFD EKKRSCRRRL  240
SDHNARRRKP QQENIQFNSG RVSPLFYDSR QPMSLLLNSA QLIHSKAAAS SSWESTQDTK  300
FSITREFTLK PERDGSTNGQ SLLAGNQLSR VVGAHSNTPN LLLPSKGTAA EVFNRGAKES  360
MFNMGTGPEF PRALSLLSTN SWGSSEPDSV SLNRPTHASH ISMAEPIMHA IPQGIPHLSC  420
EYWQAGQNSS YPRNHTLAAN THTGGFQEIE LFKAPFDSDF YLNALN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-261762491184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231248KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352180.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_006352181.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_006352182.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015166302.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A2K9ZXI30.0A0A2K9ZXI3_PETHY; Squamosa promoter binding-like protein 2
STRINGPGSC0003DMT4000847340.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-57squamosa promoter binding protein-like 2