PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00889g04016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 357aa    MW: 38881.5 Da    PI: 8.8357
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00889g04016.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-4050126278
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               C v+gC+adls+++eyhrrhkvCevhsk+++v + g+eqrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+q+
  Peinf101Scf00889g04016.1  50 CLVDGCNADLSQCREYHRRHKVCEVHSKTAKVSIGGREQRFCQQCSRFHSLVEFDDGKRSCRKRLDGHNRRRRKPQP 126
                               **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3245111IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.74447124IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-3848129IPR004333Transcription factor, SBP-box
PfamPF031104.5E-3050123IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
IVLDFKEYKL KPLLNLAIGR FLLYENCVME SSGSSKRAKA PGSLAQVAHC LVDGCNADLS  60
QCREYHRRHK VCEVHSKTAK VSIGGREQRF CQQCSRFHSL VEFDDGKRSC RKRLDGHNRR  120
RRKPQPDPMA KNSALLFSGQ QGTKLLSFGS QQIFPSAVVS SAWAGVVKTD SEMVLYNNQS  180
HINCIDSQNS FPDSSAHSSY KGGSQFQFIQ GSDHSSLPES SICQPLHDPP NSAAGIPSSG  240
RKIFSSGLNE IVDSDRALSL LSSAPAVTRE IGFSHMVQQP AASITRPQSH AAVHGLHYGG  300
LSQYPYAQDF NSKPQNSAAN SHVSNSSPLH FPGMLQNAPD GSSTSGGSQQ TLAFMWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-28501231184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106123KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0733000.0LC073300.1 Nicotiana tabacum NtabSPL13 mRNA for squamosa promoter binding protein NtabSPL13, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001311938.10.0teosinte glume architecture 1-like
RefseqXP_009621035.10.0PREDICTED: teosinte glume architecture 1-like
RefseqXP_009621036.10.0PREDICTED: teosinte glume architecture 1-like
RefseqXP_009621037.10.0PREDICTED: teosinte glume architecture 1-like
RefseqXP_009621038.10.0PREDICTED: teosinte glume architecture 1-like
RefseqXP_016443564.10.0PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443565.10.0PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443566.10.0PREDICTED: teosinte glume architecture 1-like isoform X1
RefseqXP_016443567.10.0PREDICTED: teosinte glume architecture 1-like isoform X1
TrEMBLA0A2K9ZXK20.0A0A2K9ZXK2_PETHY; Squamosa promoter binding-like protein 13
STRINGXP_009621034.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-48SBP family protein