PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00883g05009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 374aa    MW: 41858.4 Da    PI: 8.6267
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00883g05009.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40140217178
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               +CqvegC+  l +ak+yhrrhkvCe+h+kap+v++ gleqrfCqqCsrfh++sefDe+krsCrrrLa+hnerrrk+++
  Peinf101Scf00883g05009.1 140 RCQVEGCQIVLVNAKTYHRRHKVCEMHAKAPKVVLLGLEQRFCQQCSRFHSVSEFDESKRSCRRRLAGHNERRRKSSQ 217
                               6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.214138215IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.1E-33138202IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-37139220IPR004333Transcription factor, SBP-box
PfamPF031103.6E-32141214IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MENGGWNFFS NNNIESCSSN INGGSTTTVG GQISNSTHHA WDFWQLGSSS TNTSLSHDLE  60
WNTNNISLSH DPTNRQPQTF NGYNPNLNLN LGSKKHYIEN YEGGGEVVGF AMSKRGKPYF  120
CGGSGGDGGA AMPAALVVPR CQVEGCQIVL VNAKTYHRRH KVCEMHAKAP KVVLLGLEQR  180
FCQQCSRFHS VSEFDESKRS CRRRLAGHNE RRRKSSQEHF ANTRNNFQGK FRDLPVNEGR  240
ALSLLSSYSD SLIPKCNLPA RSYSSSIDEL IAGSRATSLA RQLLLEKDWH RHQHRQNLSN  300
QPKNTSFTHD CNHIALESHG WGRINDVAEH LTLNLMHVRN SEFGFLPGQK QPKEEGKEEW  360
CPGHWNSFAG GHVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-32123214184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625591.11e-146PREDICTED: squamosa promoter-binding-like protein 7 isoform X2
TrEMBLA0A2K9ZXI70.0A0A2K9ZXI7_PETHY; Squamosa promoter binding-like protein 9c
STRINGXP_009625590.11e-144(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-35squamosa promoter binding protein-like 3