PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00835g06019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 403aa    MW: 42981.5 Da    PI: 9.3347
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00835g06019.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.43.2e-4171142576
                               TT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                       SBP   5 egCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                gCeadls++k y++rhkvC +hsk+pvv+v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Peinf101Scf00835g06019.1  71 SGCEADLSDVKAYYSRHKVCATHSKSPVVIVAGIEQRFCQQCSRFHRLPEFDDGKRSCRRRLAGHNERRRKP 142
                               58********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.5365142IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.2E-3071129IPR004333Transcription factor, SBP-box
PfamPF031107.1E-3171141IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-3771146IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MNGLSNSEME SASSISGNSS SSPDSPPTGL KFGQKIYFEH VGLGVHNKSP SGSSSPVTGA  60
PAPASKKGRG SGCEADLSDV KAYYSRHKVC ATHSKSPVVI VAGIEQRFCQ QCSRFHRLPE  120
FDDGKRSCRR RLAGHNERRR KPPPGSLLST RYGSLSSSIF GGTPLHFPLL ALRLHNSLSI  180
SLALLLHADR GYINTALTEN NSRSGSFLVD FTAYPNLTEG AWPNTRSSER GWDKTTASGK  240
YLQSPWLNSS ENPTSELVLQ GSAARATSFS GPGIPSRNCF TGVSDSGGAL SLLSNESWGS  300
RNQPSGLGVN SLVNTDGGHT VQPSGSHAAP INFSGPLWGF KGNEASSTSH DMPRNLGLGQ  360
LSHHAVNQYS AELGMPQPSG RQYLDLEHSK GYDSSVQNVH WTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28731411684squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732990.0LC073299.1 Nicotiana tabacum NtabSPL9b mRNA for squamosa promoter binding protein NtabSPL9b, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019243037.10.0PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLA0A2K9ZXV10.0A0A2K9ZXV1_PETHY; Squamosa promoter binding-like protein 9a
STRINGXP_009612109.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-46squamosa promoter binding protein-like 9