PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00736g16008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRF
Protein Properties Length: 361aa    MW: 40020.1 Da    PI: 7.5997
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00736g16008.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC57.42.6e-18210241132
                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHl 32 
                               d+epgrCrRtDGKkWRC+r++++g+k+C +H+
  Peinf101Scf00736g16008.1 210 DPEPGRCRRTDGKKWRCKRDAIPGQKYCGHHI 241
                               79*****************************8 PP

2QLQ40.58.1e-15154189237
                       QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                               +FTaaQ+++L  Q+ ++Ky+++++P+P +L   i++
  Peinf101Scf00736g16008.1 154 MFTAAQFHELQLQAVIFKYIISSLPIPFHLFCTIWN 189
                               7*****************************877775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.2E-5153189IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.16154189IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-10155185IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166718.803210255IPR014977WRC domain
PfamPF088792.5E-15211242IPR014977WRC domain
SuperFamilySSF567191.65E-24260344IPR013760DNA topoisomerase, type IIA-like domain
Gene3DG3DSA:3.40.50.6706.0E-24261322IPR013759DNA topoisomerase, type IIA, central domain
PROSITE patternPS001770264272IPR018522DNA topoisomerase, type IIA, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006265Biological ProcessDNA topological change
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003918Molecular FunctionDNA topoisomerase type II (ATP-hydrolyzing) activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MNQTIRIPSI SVILFFAGFA WTNTVEINIL AISIFTSDER CVSLASCGVC SIASHVVLGL  60
KINHRKCEII PVGEVEDIDT LVYGLNCKVG ALPTTYLGLP LGASNKDQSC AYFDEGKGEE  120
DERKKKEGSP PCIKLSLGYG DSREEEKGEN AKCMFTAAQF HELQLQAVIF KYIISSLPIP  180
FHLFCTIWNS VSTSLGSANV GRFDYTSMMD PEPGRCRRTD GKKWRCKRDA IPGQKYCGHH  240
IYSFCQHGLA YDIEVSGKLS KNFIVEGDSA DGSAIQGHDR RFQAILPLRG KILNIERKDE  300
AAMHKNEEIQ NLILGLGLGV KRALFEEGCI YVGVPPLYKI CNSSVAFATY KRDIIHPSIH  360
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kpf_D8e-1625534833179ParE30
4kpf_C8e-1625534833179ParE30
4kpe_D8e-1625534833179DNA topoisomerase 4 subunit B
4kpe_C8e-1625534833179DNA topoisomerase 4 subunit B
4koe_D8e-1625534833179DNA topoisomerase 4 subunit B
4koe_C8e-1625534833179DNA topoisomerase 4 subunit B
3raf_D8e-1625534833179DNA topoisomerase 4 subunit B
3raf_C8e-1625534833179DNA topoisomerase 4 subunit B
3rae_D8e-1625534833179DNA topoisomerase 4 subunit B
3rae_C8e-1625534833179DNA topoisomerase 4 subunit B
3rad_D8e-1625534833179DNA topoisomerase 4 subunit B
3rad_C8e-1625534833179DNA topoisomerase 4 subunit B
3ltn_D8e-1625534833179DNA topoisomerase 4 subunit B
3ltn_C8e-1625534833179DNA topoisomerase 4 subunit B
3ksb_D8e-1625534833179DNA topoisomerase 4 subunit B
3ksb_C8e-1625534833179DNA topoisomerase 4 subunit B
3ksa_D8e-1625534833179DNA topoisomerase 4 subunit B
3ksa_C8e-1625534833179DNA topoisomerase 4 subunit B
3k9f_D8e-1625534833179DNA topoisomerase 4 subunit B
3k9f_C8e-1625534833179DNA topoisomerase 4 subunit B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3513873e-62AY351387.1 Nicotiana benthamiana DNA gyrase B subunit mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77981922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-23growth-regulating factor 2