PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00723g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YA
Protein Properties Length: 328aa    MW: 36132.7 Da    PI: 10.0609
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00723g00010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.63.7e-32183237358
                 CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               p+YVNaKQy++IlkRRq Rakle+++kl  k rkpylheSRh+hA++R+RgsgGrF
  Peinf101Scf00723g00010.1 183 PIYVNAKQYSAILKRRQVRAKLEAQNKL-VKDRKPYLHESRHRHAMKRARGSGGRF 237
                               9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576123No hitNo description
SMARTSM005211.0E-36179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.462180240IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.6E-28183237IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.5E-24183205IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.5E-24214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MLSFSKRGGP GKGQSFTPLF VSCSSMWNSS ELPEHVPPKS TLTAKESVVK HLPDAKKPKS  60
QFQDQDSTST LSTGEPNQVE AAMTKSITFL QNVAPHPGWG GMFEVQAESG TKAALSGENA  120
TNTLPQPLVH QNHPTACVSY PWADTYFGRL MATYGSNAII YPQMVGVTST RVALPLECTE  180
SLPIYVNAKQ YSAILKRRQV RAKLEAQNKL VKDRKPYLHE SRHRHAMKRA RGSGGRFLNT  240
KNMQQSRPSS PKYDKNIFKR HTGGNFSSSM VQHSESGSWG TSTQSGSDVT SIFSGDDMFQ  300
QPEFRVSGFP FHMGATMQEA EDFMRGGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-22183242463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221230RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8654100.0KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome.
GenBankKJ8654090.0KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351613.10.0PREDICTED: nuclear transcription factor Y subunit A-8-like
SwissprotQ93ZH29e-49NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A0V0I7060.0A0A0V0I706_SOLCH; Putative nuclear transcription factor Y subunit A-8-like
STRINGSolyc08g062210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.42e-45nuclear factor Y, subunit A8