PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00719g04004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family BBR-BPC
Protein Properties Length: 351aa    MW: 39577.8 Da    PI: 9.4876
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00719g04004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind374.22.3e-114293511301
                 GAGA_bind   1 mdddgsre..rnkg.yye...pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverd 78 
                               mdd+g+++  r+k+ + +   ++ +s+     +q+m+++aerda+i+ernlalsekkaa+aerdma lqrd+a++ern+a++erd
  Peinf101Scf00719g04004.1  29 MDDSGHHDngRHKPpQSQwlmQHqPSM-----KQIMAIMAERDAAIQERNLALSEKKAALAERDMAILQRDSAITERNNAIMERD 108
                               999999988999983322333222444.....4**************************************************** PP

                 GAGA_bind  79 nkllalllvenslasalpvgvqvlsgtksidslqq.lse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpke 161
                               n++++l+++e s+     +g q+++g+++++++qq +++ +++++++++ r+++++e++p++ aa    e +k+++++rak+pk+
  Peinf101Scf00719g04004.1 109 NAIASLQYRESSM-----SGGQIVHGVEHMHHHQQhVHHqKHMGEPTYNHRDMHMNESMPVSPAA---LEPTKPRRNKRAKEPKA 185
                               ********99984.....57789**********996444689******************88755...45555555556666666 PP

                 GAGA_bind 162 kkakkkkkksekskkkvkkesader.............................skaekksidlvlngvslDestlPvPvCsCtG 217
                                + +kk+ k +   kkvk+e++d +                             sk ++k++dl+ln+v++D++t+PvPvCsCtG
  Peinf101Scf00719g04004.1 186 VTDSKKTPKAS---KKVKRETEDLNqttfgksqewngaqemgaasddlnrqlvvSKPDWKDQDLGLNQVAFDDTTMPVPVCSCTG 267
                               65554444333...3333333331123466778899************************************************* PP

                 GAGA_bind 218 alrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                               a r CYkWGnGGWqS+CCtt++S+yPLP+++++r+aRi+grKmS++af+klL++LaaeG dlsnpvDLk+hWAkHGtn+++ti+
  Peinf101Scf00719g04004.1 268 AVRPCYKWGNGGWQSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEGNDLSNPVDLKNHWAKHGTNRYITIK 351
                               ***********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.4E-15629351IPR010409GAGA-binding transcriptional activator
PfamPF062171.7E-10329351IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MLVKQRALSN IVMLLAETDF DGNYHIYHMD DSGHHDNGRH KPPQSQWLMQ HQPSMKQIMA  60
IMAERDAAIQ ERNLALSEKK AALAERDMAI LQRDSAITER NNAIMERDNA IASLQYRESS  120
MSGGQIVHGV EHMHHHQQHV HHQKHMGEPT YNHRDMHMNE SMPVSPAALE PTKPRRNKRA  180
KEPKAVTDSK KTPKASKKVK RETEDLNQTT FGKSQEWNGA QEMGAASDDL NRQLVVSKPD  240
WKDQDLGLNQ VAFDDTTMPV PVCSCTGAVR PCYKWGNGGW QSSCCTTNLS MYPLPAVPNK  300
RHARIGGRKM SGSAFTKLLS RLAAEGNDLS NPVDLKNHWA KHGTNRYITI K
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8087240.0KJ808724.1 Nicotiana tabacum GAGA-binding transcriptional activator mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610156.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009610157.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009798749.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009798750.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009798751.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451527.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451528.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451530.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451531.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509512.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509513.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509514.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509515.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509516.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
SwissprotQ8L9991e-138BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A076L2D60.0A0A076L2D6_TOBAC; GAGA-binding transcriptional activator
STRINGPGSC0003DMT4000095340.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53532338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-122basic pentacysteine 6