PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00698g02036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 776aa    MW: 85776.5 Da    PI: 6.418
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00698g02036.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox437.8e-1451862156
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                              +n++p++ +reeLAkklg++ +qVk+W+qNrRa++k
  Peinf101Scf00698g02036.1 51 ENPHPDEITREELAKKLGMDNKQVKFWYQNRRAQMK 86
                              699*******************************99 PP

2Homeobox42.31.3e-13871222156
                               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               +n+ p+ ++reeLAkklg++ +qVk+W+qNrR+ +k
  Peinf101Scf00698g02036.1  87 ENPRPDDKTREELAKKLGMDSKQVKFWYQNRRTHMK 122
                               799*****************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-124486IPR009057Homeodomain-like
CDDcd000861.10E-105086No hitNo description
PfamPF000462.6E-115186IPR001356Homeobox domain
PROSITE profilePS5007112.6335188IPR001356Homeobox domain
SuperFamilySSF466896.84E-115186IPR009057Homeodomain-like
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
SMARTSM003896.8E-579128IPR001356Homeobox domain
PROSITE profilePS5007112.45585124IPR001356Homeobox domain
CDDcd000861.98E-1086125No hitNo description
Gene3DG3DSA:1.10.10.601.1E-1287130IPR009057Homeodomain-like
PfamPF000464.6E-1187122IPR001356Homeobox domain
SuperFamilySSF466891.96E-1087129IPR009057Homeodomain-like
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PROSITE profilePS5084836.635261497IPR002913START domain
SuperFamilySSF559611.15E-27262492No hitNo description
CDDcd088756.92E-100265493No hitNo description
SMARTSM002345.5E-35270494IPR002913START domain
PfamPF018521.4E-43271491IPR002913START domain
SuperFamilySSF559613.16E-6530751No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
IYVSAFFSVP GSHKPKMAGH SDMSEKGESS NDHVANERPS EDENESSDNL ENPHPDEITR  60
EELAKKLGMD NKQVKFWYQN RRAQMKENPR PDDKTREELA KKLGMDSKQV KFWYQNRRTH  120
MKSQSEKHES GMLKQQNDQL RVEQVTLKKA MSNPVCNRCG SQASLAKIND EERQAKIEHE  180
QLKYEVKRIT LLAEKLSVPF VSLEGSMHSA MENSAVGIGG FGGINSVETQ QPMEFDLNKD  240
PPSPLPVTPP QPTPSLDNVD VSYDKSKLMD LAVAAMNELL KLAEIGEPLW VKSLDGGGET  300
LSLEEYVPAF TPCTGMKPGY FTTEATKASA IVIINSLTLV ETLMDSRRWV EMFSCIVGKT  360
SADDVISSSS VGSWSGTLQM IQTEFQILSD MVPVRKVEFL RFCKQHAEGL WAVVDVSADS  420
VQEGSQPGEI GNCRRLPSGC VIQDMPNGHS KVTWIEHMEY NESVVNHLYR PLIRIGLGFG  480
AQRWMATLQR MSEFMAVMMS PVDATGDQAV VCSSGRRSIA MLAQRMARSF CGGVCATIHK  540
WDPIQVANGE DAKLMVRKNI GDPGELTGVI LTATNTFWLP VKQHRLIEFL LNKEKRSQWD  600
FLTNSDTLQH MAYISKGQNP DNSISVFRAN EDDTNADQNS KLILQDTSSN ATGFLLVYTT  660
VDTSAMKVVM DGGDSSSVAF LPSGISIVPD CFQDFSAATN STGTSHGFSC TGSLVTIGFQ  720
ILANSLPTAK LTSKSVKKVN DLVARTIKGI KAAFKGGRRW RGRESLPCLL LVNPCD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016449095.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
TrEMBLK4BF800.0K4BF80_SOLLC; Uncharacterized protein
STRINGSolyc03g026070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1531837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1