PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00692g04010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 745aa    MW: 81855.3 Da    PI: 5.3418
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00692g04010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-2176132157
                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                               r++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  q+k+WFqN+R+++k+
  Peinf101Scf00692g04010.1  76 RKRYHRHTQHQIQELEAYFKECPHPDDKQRKELSRELGLEPLQIKFWFQNKRTQMKN 132
                               789999************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-2257131IPR009057Homeodomain-like
SuperFamilySSF466891.38E-1968133IPR009057Homeodomain-like
PROSITE profilePS5007117.49173133IPR001356Homeobox domain
SMARTSM003891.8E-2075137IPR001356Homeobox domain
CDDcd000862.20E-2075134No hitNo description
PfamPF000461.3E-1876131IPR001356Homeobox domain
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PROSITE profilePS5084843.446258490IPR002913START domain
SuperFamilySSF559612.95E-35260489No hitNo description
CDDcd088753.39E-125262486No hitNo description
SMARTSM002345.3E-60267487IPR002913START domain
PfamPF018521.2E-54268487IPR002913START domain
Gene3DG3DSA:3.30.530.208.0E-7363482IPR023393START-like domain
SuperFamilySSF559611.05E-24511737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MASLVVNDGS NNGFADSGIP LVQSSSMMDI PFHSLDMISN TSGSEMQRLR EDFGNKSGSE  60
GNSVDDEQAV NKSLKRKRYH RHTQHQIQEL EAYFKECPHP DDKQRKELSR ELGLEPLQIK  120
FWFQNKRTQM KNQHERHENS HLRAENEKLR AENLRFREAL GNASCINCGT GQPPVGEMSY  180
DEHQLRLENT RLREEIERIS NIAAKYVGKP FLNHNGYSQS NTRPLDIGIP AFSAQQSVDG  240
EAYGDHGEDV ISSIIGPSEA EKPFIIELAV AAMEEFVQMA QMAEPLWFPS IERGTTLLNE  300
EEYFRIFPRG IGPKPAGFKT EASRETAVVI MNHVNLVEIL MDVNHWSSMF AGVVSRASTI  360
DVLSTGVAGN FNGALQVILA EFQVPSPQVP TRECYFARYC KHRADGTWAV VDVSLDHLRA  420
TPVDRCRRRP SGCLIQEMPN GYSKVTWVEH VEVDDGAVHD IYKPLVSSGL AFGAKRWLAT  480
LDRQCERLAS AMATNIPNND ISNMVLANQD SRKSMLKLAE RMVISFCSGV SATTANQWTT  540
LSGSGSDDVR VMTRKSVDDP GRPPGIVLSA ATSFWLPISP KTVFDFLSDE NTRNEWDILS  600
NGGVVQEMAH IANGRETGNC VSLLRVDSSN SNQSNMLILQ ESITDPTGSF VIYAPVDIAA  660
MNIVLGGGDP DFVALLPSGF AILPDGPPGS GRPNGSGGSL LTVAFQILVD SVPTAKLSLG  720
SVATVNNLIS CTVERIKSAL LSETP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766038.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like
RefseqXP_016447957.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2