PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00576g01021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family Dof
Protein Properties Length: 413aa    MW: 44932.6 Da    PI: 9.6372
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00576g01021.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.6e-383090262
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              +e+ ++cprC+s ntkfCyynnyslsqPr+fCk+CrryWtkGGalr vP+Ggg+rknkk +
  Peinf101Scf00576g01021.1 30 QEQVINCPRCNSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRSVPIGGGCRKNKKIK 90
                              67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-252484IPR003851Zinc finger, Dof-type
PfamPF027011.3E-323288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9193488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MAPDNKAEKS QSKEGNQSSS DRKTSTVRRQ EQVINCPRCN SPNTKFCYYN NYSLSQPRHF  60
CKTCRRYWTK GGALRSVPIG GGCRKNKKIK SSSKDYSSAT SSSDIGGFNL FQGFSPAMDF  120
PKLNSSTTYS IFNENSSFGG ISTSGSSPCF NLEHSAGSLM GFNLYLSKSL LKQGGGCRKN  180
KKIKSSSKDY SSATSSSDIG GFNLFQGFSP AMDFPKLNSS TTYSIFNENS SFGGISASGS  240
SPCFNLEHSA GSLMGFNLYL SKSLLKQGKV TGGVRGMGSV NDTGNLASSI ESLSSINQDL  300
HWKLQQQRLA NMLFGGEDQK DSNVSSVPLG NIQKPQPILF QKLENFKPET AFGNNTSRKE  360
NSGCGNFATE WFFDNSFTSV NPTPTNSSNG NANENSNSWN DFQAWSNLNQ YST
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021670145.12e-67dof zinc finger protein DOF5.7-like
SwissprotQ9LSL64e-32DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A2G2VDA54e-65A0A2G2VDA5_CAPBA; Dof zinc finger protein DOF5.3
STRINGEOX918921e-65(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-32Dof family protein
Publications ? help Back to Top
  1. Castorina G,Fox S,Tonelli C,Galbiati M,Conti L
    A novel role for STOMATAL CARPENTER 1 in stomata patterning.
    BMC Plant Biol., 2016. 16(1): p. 172
    [PMID:27484174]