PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00500g03006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 523aa    MW: 57872.3 Da    PI: 8.192
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00500g03006.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.41.5e-41165240277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv+gC +dls+ k yh+rhkvCevhsk+++v+v+g++qrfCqqCsrfh l +fD++krsCr+rLa+hnerrrk++
  Peinf101Scf00500g03006.1 165 CQVQGCGKDLSSSKVYHKRHKVCEVHSKTAKVIVNGIQQRFCQQCSRFHLLGDFDDGKRSCRKRLAGHNERRRKPH 240
                               **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-33160226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.137162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-38163242IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31165238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MESWSFVSGG RGFVSEESVS LDNGIVRGRN GVISWEVNTL CSFGSTVINS SQEVIGNQES  60
PELDTPNNHI RDDLTNKFGD GRVFSSVTAP HSAFSMESES SSKLSRSVVE SNCRDPSVID  120
LELGRFADLK DEQSLISSKI MTNLTSRVPA KRMRAGGLNY QTPFCQVQGC GKDLSSSKVY  180
HKRHKVCEVH SKTAKVIVNG IQQRFCQQCS RFHLLGDFDD GKRSCRKRLA GHNERRRKPH  240
TGSAGTRFRA NSFAMPSSLC QNVLGSSLLH QSKYEMDWYK NVKVEDTADY SPIANGNSQP  300
KSHFASYHAE KQCPPLHDEG IMSFTRSKID ESSKSYLHDM GRSDFVTRSM FQSTSIGGDV  360
LHVLDSSSTI QGLSGISNSS SAHSLLSSQS QDSSNHSSLI PTAHHLITPS SNARYNATHI  420
SEKLLGDGQQ TLSTRVIDTF NSTAVNSAET SLEQILVSNS SNDCSINRII QGSEYINTKD  480
YLPCEDGLTI DLLQLSSQLQ RVEHQRRFMQ VKHINARNTR ANR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-301642381084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313103.10.0squamosa promoter-binding-like protein 6
RefseqXP_009777325.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_009777331.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A2K9ZXH60.0A0A2K9ZXH6_PETHY; Squamosa promoter binding-like protein 6c
STRINGXP_009777325.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-47SBP family protein