PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00488g04015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 499aa    MW: 56161.4 Da    PI: 8.0372
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00488g04015.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.4e-41188263277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv gC++dls+ k+yh+rhkvC+ hska++v+v+g+eqrfCqqCsrfh l  fDe+krsCr+rLa+hnerrrk+q
  Peinf101Scf00488g04015.1 188 CQVYGCNKDLSSSKDYHKRHKVCDEHSKAAKVIVNGIEQRFCQQCSRFHLLGAFDEGKRSCRKRLAGHNERRRKPQ 263
                               **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.5E-34182249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.111185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38186267IPR004333Transcription factor, SBP-box
PfamPF031104.5E-32188261IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MEPMNYALEG RGFLFHDNIE LPISRLATSR NLNHFCDVDR IMFGTSQEIS ENTEFGGSGI  60
ADILKKIEAS NPWSGGLGVE SDEVEPETAN RHNDSISLPI GLKLERLIDY GEARSCQSSK  120
GSSVLSLAES LLPLGKSQHG RREEPSIVYR EVKSNSPLVE NSAMYSLEPL LLGKRSRTTN  180
LHSQVPLCQV YGCNKDLSSS KDYHKRHKVC DEHSKAAKVI VNGIEQRFCQ QCSRFHLLGA  240
FDEGKRSCRK RLAGHNERRR KPQFDTHWGK LNSEYVVMAG AKLLDMTSQR RVPFLFPEIH  300
PGSPFCQERC EDRCKHIKLE ETPICISELD VAVTKKQSPT KNLQHHHGMR KQNSTKFHLG  360
ATVSVQELSA GQNSTCALSL LSAHSQYLLH HSENHCAYLK RDHSLEKICG ISDSRSFSSN  420
QLYPSEGSDI DKIAASTEVL RERHVRRSNS MNSKHGLCPE NGPTMDLVQL SSHLQRVEQL  480
KNAVQVKQED DIFSCFTNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28183261684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732951e-139LC073295.1 Nicotiana tabacum NtabSPL6-7 mRNA for squamosa promoter binding protein NtabSPL6-7, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600444.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_018626210.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2K9ZXI10.0A0A2K9ZXI1_PETHY; Squamosa promoter binding-like protein 6b
STRINGXP_009600444.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-55SBP family protein