PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00437g14022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 968aa    MW: 107475 Da    PI: 7.6389
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00437g14022.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.69.9e-40141218178
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               +Cqv++C++dls+ak+yhrrhkvC+vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Peinf101Scf00437g14022.1 141 CCQVQDCQVDLSNAKDYHRRHKVCDVHSKAAKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 218
                               6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-31135203IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.906139216IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.23E-37140221IPR004333Transcription factor, SBP-box
PfamPF031105.1E-29142215IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.3E-7240265IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.22E-7746854IPR020683Ankyrin repeat-containing domain
CDDcd002041.43E-7748855No hitNo description
Gene3DG3DSA:1.25.40.202.3E-7748857IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 968 aa     Download sequence    Send to blast
MEAHNCNGKK SMEWDLNDWK WDGDLFRATP LNSLPLDCRS KEFLPIGSKI QETSRILNLN  60
SLSSGSDEMI LLGNDKGRKE LEKRRRGAVI IDENDEVESL NLKLGEQIYP MMEGEVEKWE  120
EKSGKKKKIG SGNSSNSRVV CCQVQDCQVD LSNAKDYHRR HKVCDVHSKA AKALVGNVMQ  180
RFCQQCSRFH VLQEFDEGKR SCRRRLAGHN KRRRKTHPEN VANGASTNDE RGTNSSDQTK  240
DQDLLSHLLR NLASGAAANN ERNTPALLPA PPDVHNTGTS MGAPKEDYPR PNGDCLIIPA  300
SEMTEKRTGT SDAERGISQN LCASQPDFLY RRKESLPICA NASATTSASV KLIDLNNIYD  360
DSQDGNEKLL NSSSANPGAA SSSCPLWIYH DPHKSSPPSI SGNPRSTPSL STSTSSGEAQ  420
SRTDRIVFKL FGKDPSDFPT ALRKQILDWL SNSPTDIESY IRPGCIILTL YLQMDKSIWK  480
ELYCDLNSSL RKLLNASADS FWQTGWIYTR VNDRVAFLFN GQVVLDTPLP VKSHWSCGIS  540
IVKPIAVCAS ERVQFLVKGF NLSRPTTRLL CALEGQYLVQ GNCTDMMLGA DSCMDHEEIQ  600
SLSFPCLMPN VIGRGFIEVE DHGLSSNFFP FIVAEKDVCS EIRTLESIIE VAETAGGFLG  660
GTEELQARDQ ALDFLHEAGW LLHRISRVGS DANLNLFPFQ RFKWLIQFSI DHDWCAVVKK  720
LLDVLSNGII DVGQQSSLDV ALREVGILHQ AVRRKCRSMV EVLLRYRAHG AFDKSGLQKQ  780
QGGDSYLFRP DEVGPGGLTP LHVVASLSGF ENILDALIDD PGQVGIEVWK SARDSTGLTP  840
NDYACLRGHY SYIHMVQKKI KEKPGDGHVV LNIPGSLLDN SLKKKLSDGH RSVKVASLQT  900
EKSQCRQCKQ KLSYGNSGSS VALYKPAMLS MVAIAAICVC VALLFKSSPE VHYSLRPFRW  960
EQLKYGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30130215184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210216KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015076164.10.0squamosa promoter-binding-like protein 1
TrEMBLA0A2K9ZXJ10.0A0A2K9ZXJ1_PETHY; Squamosa promoter binding-like protein 12b
STRINGXP_009793310.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12