PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00336g22003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family GRAS
Protein Properties Length: 577aa    MW: 65687.4 Da    PI: 4.9624
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00336g22003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.27e-902075751374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklf 84 
                               lv+lLl++Ae v++++++la++ ++r    as +g+p+qRl +yf+eAL++r+ r ++ ++++  + +  s+    ++  +l+  
  Peinf101Scf00336g22003.1 207 LVHLLLAAAEEVDQQQFHLASQSIERCLWKASHSGNPIQRLCFYFAEALQERIDReTGRSTSEERKFRYHSTLALGTTPESLT-C 290
                               68*****************************************************5666666666666666555545545544.4 PP

                      GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakf 168
                               +   P+ ++ +++  qa+ e v g++++H +Df+i  G+Q   L+qaLa +R+++   l+iT++g+   ++ke++eetg+rL +f
  Peinf101Scf00336g22003.1 291 HTEIPFSQVMQFAGVQAVIENVRGAKKIHLVDFNIRSGIQCTGLMQALAeQRDHPIELLKITAIGH---QEKEKIEETGRRLLSF 372
                               5556*********************************************66668888*********...579************* PP

                      GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                               A++l++pf+f+v+   +++dl+ e ++vk +E++aV +   l ++  +++ l++    +++++++l+P vvvv+e ea+hns+sF
  Peinf101Scf00336g22003.1 373 ANSLNLPFSFDVVFLLDMKDLREELINVKADETVAVYCNTVLRTMICRPAYLDN----TMRVIRRLRPSVVVVCEVEANHNSPSF 453
                               ************9999*****************************955555555....*************************** PP

                      GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               l+rf++al +y +lfd++e  + r++  r+ +E + lg+ i n+va+eg+er+ r+ +l+ Wr+ + ++G+ +++lse+   qa+
  Peinf101Scf00336g22003.1 454 LNRFVDALFFYGVLFDCFEDCMDRDNPCRKRIEVFHLGEGILNIVAAEGDERFTRNVKLNVWRAFFARFGMVEMELSESSWYQAN 538
                               ************************************************************************************* PP

                      GRAS 339 lllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               l+l++++ +   +++++ + l+ gWk+ p+ sv+ W+
  Peinf101Scf00336g22003.1 539 LILKQFSsGSSCNLQNDGKGLLVGWKGTPIKSVTIWK 575
                               *******8888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.945181554IPR005202Transcription factor GRAS
PfamPF035142.4E-87207575IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MDHVSIPNID FSVLQGGHNQ LQECERNGLV NSDEIDPWFE LNSEDIDSLY SVFDLKFQEN  60
KSDKQVELLE NQQQNISDYW SHSDDSSNIG LPMQPDQIQN GIQPQVPKLG NLQEEIINPI  120
SLASLELLNN CGRLFKKSSE ENLRSALSNE ARVGNSHKIS TEEILQAAGE RYIQYSTQRV  180
DGLSMFIHPY ASALSALSID ETRDMELVHL LLAAAEEVDQ QQFHLASQSI ERCLWKASHS  240
GNPIQRLCFY FAEALQERID RETGRSTSEE RKFRYHSTLA LGTTPESLTC HTEIPFSQVM  300
QFAGVQAVIE NVRGAKKIHL VDFNIRSGIQ CTGLMQALAE QRDHPIELLK ITAIGHQEKE  360
KIEETGRRLL SFANSLNLPF SFDVVFLLDM KDLREELINV KADETVAVYC NTVLRTMICR  420
PAYLDNTMRV IRRLRPSVVV VCEVEANHNS PSFLNRFVDA LFFYGVLFDC FEDCMDRDNP  480
CRKRIEVFHL GEGILNIVAA EGDERFTRNV KLNVWRAFFA RFGMVEMELS ESSWYQANLI  540
LKQFSSGSSC NLQNDGKGLL VGWKGTPIKS VTIWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-4122557521375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477658.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1S4AMK00.0A0A1S4AMK0_TOBAC; DELLA protein RGL1-like
STRINGXP_009616214.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-51RGA-like 1