PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00276g05013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 357aa    MW: 39499.9 Da    PI: 5.6333
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00276g05013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.93.6e-071143436
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                              + C+ ++   ++ fC+ ++ +lC  C +++H  
  Peinf101Scf00276g05013.1 11 KLCDSCKTTSATVFCRADSAFLCLGCDSKIHAA 43
                              68******99*********************54 PP

2zf-B_box28.14.2e-095398342
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               ++C+ +e+ +++  C+ +   lC +C   +H+       H+++p+
  Peinf101Scf00276g05013.1 53 VWVCEVCEQAPATVTCKADAAALCVTCDRDIHSAnplarrHERIPV 98
                              689*****************************66889999999885 PP

3CCT70.54.1e-24294337144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Peinf101Scf00276g05013.1 294 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 337
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.182855IPR000315B-box-type zinc finger
SMARTSM003361.5E-10855IPR000315B-box-type zinc finger
PfamPF006432.1E-51150IPR000315B-box-type zinc finger
CDDcd000211.66E-61255No hitNo description
PROSITE profilePS5011910.7935198IPR000315B-box-type zinc finger
PfamPF006432.4E-75398IPR000315B-box-type zinc finger
CDDcd000211.13E-75498No hitNo description
SMARTSM003361.2E-105698IPR000315B-box-type zinc finger
PfamPF062032.4E-18294336IPR010402CCT domain
PROSITE profilePS5101716.896294336IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGSESWSLTA KLCDSCKTTS ATVFCRADSA FLCLGCDSKI HAANKLASRH ARVWVCEVCE  60
QAPATVTCKA DAAALCVTCD RDIHSANPLA RRHERIPVVP FYDSAVAKSH GGSEDDKYLD  120
VNVVEAEEEA EAASWILPTP NNNNNNNNND NNNNNTTTKG IKSGEEVEYK SADYLFNDMD  180
SYLDMDFMSC DQKPHIIHQQ HYCSDGVVPV QCKNEITQFQ GPVVDGFPTY EMDFPGSKPY  240
LYNFSSQSIS QSVSSSSLDV GVVPDHSAMA DVSNTFVTNP SADAVANPVS GLDREARVMR  300
YREKRKNRKF EKTIRYASRK AYAETRPRIK GRFAKRTEIE IDSFIAADAS YGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758697.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016478497.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-105COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A1S4AP330.0A0A1S4AP33_TOBAC; zinc finger protein CONSTANS-LIKE 4-like
TrEMBLA0A1U7URH80.0A0A1U7URH8_NICSY; zinc finger protein CONSTANS-LIKE 4-like
STRINGXP_009758697.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-103CONSTANS-like 4