PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00264g05032.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 422aa    MW: 45620.1 Da    PI: 5.4621
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00264g05032.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box171.2e-054678434
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedCllee..H 34
                               +C+++++ ++   C d++++lC+ C +++   
  Peinf101Scf00264g05032.1 46 LICEKCSSMPAVTRCIDDEMCLCQACESNGngC 78
                              68************************9886552 PP

2CCT62.31.5e-21366409144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Re+a++RY+eK+ktR ++K+irY+sRKa+A++R+RvKGrFvk+ 
  Peinf101Scf00264g05032.1 366 REKAKMRYNEKKKTRMYSKQIRYASRKARADTRKRVKGRFVKAG 409
                               99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.0E-6147IPR000315B-box-type zinc finger
CDDcd000210.00209347No hitNo description
PROSITE profilePS5101714.565366408IPR010402CCT domain
PfamPF062031.1E-16366408IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MEPLCDFCGL VRPVVYCTSD LARLCFDCDG LVHSANFLSR RHPRSLICEK CSSMPAVTRC  60
IDDEMCLCQA CESNGNGCTV PGHRRQKLNS YSGCPSSAEF AKIWSGVNEM ANSSNVANTC  120
SFDNSCSSLS ISENNCSTPS LEPRGNELSS LVTIPSIPIP CNPTYLPPFK NQPASYFPEG  180
SSCSTIKDLG FQGGDNLLEA IDLDDATLSL DGGCDIFGSS RQSHPTFASE ESRGLDCLVM  240
EKNLSVTESK GHAEPALEAS SSGHQECIGF QSSQMAAASS SMNLLHTMSA TANSMLMNSG  300
CNGNIGLAFP PGPVHSSISL SLSNITGESS AATDCQDCGL SPDFLTGESP WELNLDMETS  360
DRKQAREKAK MRYNEKKKTR MYSKQIRYAS RKARADTRKR VKGRFVKAGE AYDYDPLAAR  420
DF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-36HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019246655.11e-165PREDICTED: zinc finger protein CONSTANS-LIKE 12-like isoform X1
TrEMBLA0A1J6J0L71e-164A0A1J6J0L7_NICAT; Zinc finger protein constans-like 12
STRINGXP_009787133.11e-161(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42311726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-84B-box type zinc finger protein with CCT domain