PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00255g11004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 191aa    MW: 21938.8 Da    PI: 8.0139
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00255g11004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer74.81.2e-231366357
               ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                               v+Y eC++N Aas  g+a+DGCgEf+p+ g++gt++ + CaAC CHRnFHR+ +
  Peinf101Scf00255g11004.1 13 VVKYWECMHNYAASSMGYALDGCGEFCPT-GSHGTPEYFICAACHCHRNFHRKME 66
                              689*************************8.999*******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.6E-211465IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-121464IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.1E-201564IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152321.4081665IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.11E-7123184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-13129184IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MANSHNKHLH GTVVKYWECM HNYAASSMGY ALDGCGEFCP TGSHGTPEYF ICAACHCHRN  60
FHRKMEIVDV EVALEIPSNH GKSWGLPSQT YDKNTVVATP SPLPMEAEIG GGEIDQVDRS  120
YKRNNCSYPR IRLNPEQREK VKAFAEKVGW RWSKYNEEVK PFCEEIGITP NFLKNWIDNN  180
RRRFGPNKII Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799887.11e-62PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_016452911.11e-62PREDICTED: zinc-finger homeodomain protein 5-like
TrEMBLK4B1V83e-50K4B1V8_SOLLC; Uncharacterized protein
STRINGSolyc01g103830.1.19e-50(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA108891118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-29homeobox protein 24