PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00239g01015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 543aa    MW: 59841.9 Da    PI: 8.6924
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00239g01015.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.5e-42150225277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv+gC +dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  Peinf101Scf00239g01015.1 150 CQVQGCGKDLSSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 225
                               **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.2E-34144211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.898147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-39148227IPR004333Transcription factor, SBP-box
PfamPF031101.8E-32150223IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MESWSYVSGS KGFVSEESVS VNDGTVRGKN GWELNTPWSF KNTIVENQDF GLSSKLCGAS  60
AFVTTEDESG QPCTQSIPRY MEEESSSKNS MSSVVESNSK DSSSLIDLKL GRFPDAPQSF  120
KSPKVMQNLS IHVSTIPAKR NRLSSQTPFC QVQGCGKDLS SSKDYHKRHK VCEVHSKTAK  180
VIVNGIEQRF CQQCSRFHLL AEFDDGKRSC RKRLAGHNER RRKPHAGLHS GRAGRLFQSY  240
AGTRFQGTSF ATSSFLCQDI LGCNLLHQPK HDTHDWYKNV KVEHGSDYSP RLTMPFAYGH  300
SQPRPLFTSY HAEKHCPSLH DGMTVIRSKH NESSNSYLNG MGGSDFVSRT LFHGISMGSE  360
VLNVMDSPSA FQGISGMSSS GCALSLLSSQ SQDSSNYSSV VPNAHHLITP SSNAHCNVTH  420
TTEKLPGVNL KGSTSIASSI FNFSGVNSAE GHLEQILSNN CGINSSIQGS EYVNTKNLLS  480
FEDGPTIDLL RLSSQLHRVE HQRHSMKCKC NPHRCLLICT ITGGNKQSAF QSPANRNWIG  540
WKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-30144223584squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001312117.10.0squamosa promoter-binding-like protein 6
RefseqXP_009615765.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_009615766.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016449891.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016449892.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_018630442.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2K9ZXJ40.0A0A2K9ZXJ4_PETHY; Squamosa promoter binding-like protein 6e
STRINGXP_009615765.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-46SBP family protein