PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00204g10013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 722aa    MW: 79820.9 Da    PI: 6.2556
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00204g10013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-1960115156
                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               +++ +++t++q++e+e++F++n++p+ ++r+eL k+lgL+  q+k+WFqN+R+++k
  Peinf101Scf00204g10013.1  60 KKRYHRHTQHQIQEMETFFKENPHPDDKQRKELGKRLGLEPLQIKFWFQNKRTQMK 115
                               688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-1944117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-2145111IPR009057Homeodomain-like
PROSITE profilePS5007116.98957117IPR001356Homeobox domain
SMARTSM003894.4E-1858121IPR001356Homeobox domain
CDDcd000864.77E-1860118No hitNo description
PfamPF000464.8E-1760115IPR001356Homeobox domain
SuperFamilySSF559616.87E-28239476No hitNo description
PROSITE profilePS5084837.688239477IPR002913START domain
CDDcd088751.78E-108243473No hitNo description
SMARTSM002345.0E-56248474IPR002913START domain
PfamPF018521.4E-45249474IPR002913START domain
SuperFamilySSF559613.43E-26494718No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MFKPNMFESH HHLLDMSTNK MPENEMDFIR DEEFESKSGT EIMEAPNSGD DQDPNTRPKK  60
KRYHRHTQHQ IQEMETFFKE NPHPDDKQRK ELGKRLGLEP LQIKFWFQNK RTQMKAQHER  120
HENTQLRNEN EKLRNENIRY KEALSNAACP NCGGPAAIGE MSFDEQHLRI ENARLREEID  180
RISGIAAKYV GGKPILSYPA LPPPEAPRSL DLGFGPQSGL LGEMYNASDL LRTAVSGLTD  240
AEKPMVIELA VAAMEELVRM AQTSEPLWLS SPKGNIEILS EEEYVRAFPR GIGPKPISLR  300
TEASRESAVV IMNHINLVEI LMDVNQWTNV FAGLVSKAMT LEVLSTGVAG NYNGALQVMT  360
AEFQVPSPLV PTRENYFVRY CKQHADGTWA VVDVSLDNLR PTSVSRCRRR PSGCLIQELP  420
NGYSKVSPTS ENLIGLEFQH WLSDISSWLK VIYILSLAFG AKRWVATLDR QCERLASAMA  480
NNIPTGDVGI ITSPAGRKSM LKLAERMVLS FCAGVGASTT HTWTTLSGSG ADDVRVMTRK  540
SVDDPGRPPG IVLSAATSFW LPVSPKRVFN FLRDENSRSE WDILSNGGLV QEMAHIANGR  600
DPGNCVSLLR VNSGNSSQSN MLILQESSTD STGSYVIYAP VDIVAMNVVL NGGDPDYVAL  660
LPSGFAILPD ANPEVGTPCT LLTVAFQILV DSVPTAKLSL GSVATVNSLI KCTVERIKTA  720
VT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605863.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_009605864.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_016440385.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLA0A022QKL80.0A0A022QKL8_ERYGU; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein