PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00197g03012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 855aa    MW: 95484 Da    PI: 6.2434
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00197g03012.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.74.1e-25911472278
                               T--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP  22 kvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               k  ++hska  +lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+qa
  Peinf101Scf00197g03012.1  91 KRRRMHSKAGRALVGNVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQA 147
                               44569*************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114122.05168145IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.4E-1588132IPR004333Transcription factor, SBP-box
PfamPF031101.9E-1694144IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-2294150IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.39E-7628742IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.1E-5631743IPR020683Ankyrin repeat-containing domain
CDDcd002041.52E-6632742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 855 aa     Download sequence    Send to blast
MEASVENRFY RTDLRGGGLG KRSLEWNLTD WKWDGDLFIA TPLGHQNPSN YQFLPVENRI  60
NHGSSNSSSS CSDEVVVVNH NEQQRRRELE KRRRMHSKAG RALVGNVMQR FCQQCSRFHA  120
LQEFDEGKRS CRRRLAGHNK RRRKTQAESV VNNNSLNDGQ ASANGTNHTE DQDLLSHLLR  180
SLASQGSMNG DKGLSGLLQE SSNLLNNRSI LRNPEIVALL TNGSQAPPRS KEHQFTNSAT  240
EMPQKSLDTN DIRLEDGRTA SSQSPGNLFS NQSNSQAYVP GRESTTGRSK LMDFDLNDVY  300
VDSDDGVEDI ERSPVPECPS WLQQDSHQSS PPQTSGNSDS ASAQSPSSSS GDTQSRTDRI  360
VFKLFGKDPS DFPFVVRAQI LDWLSHSPTE IESYIRPGCV VLTVLLDMSL PYQSNEQSTI  420
LSVRPIAVPV SGRAHVFVKG YNLSKPSSRL LCALEGNYLV PEVNNEVEEH VDGFDKDDKL  480
QSLNFTCSVP AVTGRGFIEV EDQGLSNGFF PFIIAEEDVC SEIRVLESEI ELTSADYVEG  540
QTNNMEARNQ AMDFIHELGW LFHRNNLKAR LEHSGPNAVL YPLKRFKWLM DFSVDHEWCA  600
VVKKLLNILL DGTVGAGEDT FLKFALSDMG LLHRAVRRNS RPLVELLLTY TPEKVADELS  660
SEYQSLVGVH GEFLFRPDSV GPAGLTPLHV AAGIDGSEDV LDALTDDPGK VAVEAWKNTR  720
DSTGFTPEDY ARLRGHYSYI HLVQRKICRK ASSGHIVVDI PTVVSVENSN QKEECAITNF  780
EISRIERRPT RPCGLCHKKL AYGTRSRSLL YKPAMFSMVA MAAVCVCVAL LFRGSPEVLY  840
IFRPFRWEMV DFGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-17951443584squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474508.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A1S4AD930.0A0A1S4AD93_TOBAC; squamosa promoter-binding-like protein 1 isoform X1
STRINGXP_009592086.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]