PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00175g04023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 812aa    MW: 88959.3 Da    PI: 6.3007
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00175g04023.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.8e-21107162156
                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Peinf101Scf00175g04023.1 107 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 162
                               678899***********************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-2293164IPR009057Homeodomain-like
SuperFamilySSF466891.03E-2095164IPR009057Homeodomain-like
PROSITE profilePS5007117.54104164IPR001356Homeobox domain
SMARTSM003893.1E-17105168IPR001356Homeobox domain
CDDcd000861.30E-18106164No hitNo description
PfamPF000462.0E-18107162IPR001356Homeobox domain
PROSITE patternPS000270139162IPR017970Homeobox, conserved site
PROSITE profilePS5084844.034307544IPR002913START domain
SuperFamilySSF559612.2E-33309541No hitNo description
CDDcd088752.98E-123311540No hitNo description
SMARTSM002341.9E-50316541IPR002913START domain
PfamPF018522.9E-57316541IPR002913START domain
SuperFamilySSF559615.77E-24560798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MFNSPGLSLA LVSHKNLIFT LSSIGHGFSY ISPFADLSGK YVVVQTGMEG GQSEVTRMPE  60
TYLEGNNSNG RRSREEEPES RSGSDNLEEG ASGDDQEDAA DKPPRRKKRY HRHTPQQIQE  120
LEALFKECPH PDEKQRLELS KRLCLETRQV KFWFQNRRTQ MKTQLERHEN SLLRQENDKL  180
RAENMSIREA MRNPICTNCG GPAMIGEISL EEQHLRIENA RLKDELDRVC GLAGKFLGRP  240
ISSLVTSMPP PMPNSSLELG VGNNGFVVGG LSNVPTTLPL APSPDFGVGI ANSLPMVTRQ  300
ASTGIERSLE RSMYLELALA AMDELVKLAQ TDEPLWFRSM EGGGKEILNH EEYMRTFTPC  360
IGMRPNSFVS EASRETGMVI INSMALVETL MDSNKWAEMF PCLIPRTSTT DVISSGMGGT  420
RNGALQLMHA ELQVLSPLVP IREVNFLRFC KQHAEGVWAV VDVSVDNIRE ASGAPTFPNC  480
RRLPSGCVVQ DMPNGYSKVT WVEHAEYDES VIHHLYRSLI SAGMGFGAQR WVATLQRQCE  540
CLAILMSSTV SSRDHTAITP SGRRSMLKLA QRMTNNFCAG VCASTVHKWN KLCAGNVDED  600
VRVMTRKSVD DPGEPPGIVL SAATSVWLPV SPQRLFDFLR DERLRSEWDI LSNGGPMQEM  660
AHIAKGQDHG NCVSLLRASA MNTNQSSMLI LQETCIDAAG ALVVYAPVDI PAMHVVMNGG  720
DSAYVALLPS GFSIVPDGPG SRGPNNANCG SNGPSCNGGP GERISGSLLT VAFQILVNSL  780
PTAKLTVESV ETVNNLISCT VQKIKAALHC ES
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2221850.0GQ222185.1 Solanum lycopersicum cultivar M82 cutin deficient 2 (CD2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009782443.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_016465399.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM1CNN30.0M1CNN3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000713770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein