PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00126g02006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 778aa    MW: 85583.1 Da    PI: 6.1146
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00126g02006.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.8e-20112167156
                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               +++ +++t++q++eLe+lF+++++p++++r eL+k+l L +rqVk+WFqNrR+++k
  Peinf101Scf00126g02006.1 112 KKRYHRHTPKQIQELEALFKECPHPDEKQRLELSKRLCLATRQVKFWFQNRRTQMK 167
                               688999***********************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2197169IPR009057Homeodomain-like
SuperFamilySSF466893.43E-2097169IPR009057Homeodomain-like
PROSITE profilePS5007117.556109169IPR001356Homeobox domain
SMARTSM003894.0E-17110173IPR001356Homeobox domain
PfamPF000465.6E-18112167IPR001356Homeobox domain
CDDcd000864.64E-17114169No hitNo description
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084833.082295521IPR002913START domain
SuperFamilySSF559618.55E-25297518No hitNo description
CDDcd088752.53E-106299517No hitNo description
SMARTSM002341.0E-37304518IPR002913START domain
PfamPF018528.1E-44304518IPR002913START domain
SuperFamilySSF559611.53E-24537764No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 778 aa     Download sequence    Send to blast
MNFGGFLDSS GDGGSARIFT NSNNNNMSIS TIAQSMSKSM FNSPGLSLAL QTGIEGQGEI  60
ARMPENYDTN TNNSVGRRGR DEEQESRSES DNLEGASGDD QDTDEKPPKK KKKRYHRHTP  120
KQIQELEALF KECPHPDEKQ RLELSKRLCL ATRQVKFWFQ NRRTQMKTQL ERHENSLLRQ  180
ENDRLRAENM SVREALRNPM CTNCGGPAII GEISIEEQRL RIENSRLKDE LDRVCTLAGK  240
FLGRPISSMA PLALPNSSLE LGVGNNGFEV LSNVQSTIPL GTSEFGVGIS NGIEISIERS  300
MYLELALAAM DELVKMAQTD DTLWLRNIEG GTEILNHEEY LRTFTPCIGM RPNTFVSEAS  360
RETGMVIINS LALVETLMDS NKWAEMFPCL IARTSTTNVV SSGVGGTRNG ALQLMHAELQ  420
VLSPLVPIRE VNFLRFCKQH AEGVWAVVDV SIDTIRDTSG APTFQNYRRL PSGCVVTWVE  480
HAEYDENVVH QLYRPLISTG MGFGAQRWVA TLQHQCECLA ILMSSSVPSR DHTALTPSGR  540
RSMLKLAQRM TNNFCSGVCA SSIHKWNKLC IGNVDEDVRV MTRKSVDDPG EPSGIVLSAA  600
TSVWLPVSPQ RLFEFLRDER LRSEWDILSN GGPMQEIAHI AKGQDHGNCV SLLRASGTNT  660
NQSSMLILQE TCIDPAGSVV VYAPVDIPAM HVVMNGGDSA YVALLPSGFS IVPDGPGSRG  720
PKIGGPDQRV SGSLLTVAFQ ILVNSLPTAK LTVESVETVN NLISCTVQKI KAALHCES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234657.20.0cutin deficient 2
RefseqXP_015059298.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK4AZA30.0K4AZA3_SOLLC; Uncharacterized protein
STRINGSolyc01g091630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein