PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00102g44013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family G2-like
Protein Properties Length: 412aa    MW: 47990.8 Da    PI: 9.8978
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00102g44013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.42.5e-3185138255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               prlrWtp+LH++Fv+a+e+LGG+e+AtPk +l+lm++ gL+++hvkSHLQ+YR+
  Peinf101Scf00102g44013.1  85 PRLRWTPDLHRSFVHAIERLGGQERATPKLVLQLMNLRGLSIAHVKSHLQMYRS 138
                               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-2981139IPR009057Homeodomain-like
PROSITE profilePS5129410.87181141IPR017930Myb domain
SuperFamilySSF466891.65E-1482139IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2285140IPR006447Myb domain, plants
PfamPF002495.2E-886137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MTESAKQGNE EMEYITGKAS SDSSSHRASS IDLNEDNKEE TEEATEFSGE ECSEKTTEGN  60
SEDNISGDAH VQKKNVRQYV RSKTPRLRWT PDLHRSFVHA IERLGGQERA TPKLVLQLMN  120
LRGLSIAHVK SHLQMYRSKK LDECGQVLGQ GYRAMQGRSY FYGDLRQRYN PLQDFKMKNG  180
AIVLARNFDN GDHVKGQFQK EYSRSQFHAK GIFSRYFESL KGEDLRENKK LFRMKSWQTQ  240
ERLSTPKQFQ EHKSNEICSI RSSQFLEEKR WPPREFITNK WEEKRSQYLL HPNVQPYYKW  300
NCRYNTVLEQ NSGTSFRREN IVNGLRIMFA GGGELTVSVA GKKKYLVVVV MYWRWSGGER  360
LQRWGREGAG RDKLSTDYKN ENRPHQSKMR DQSDHINTML SLSLPTYSSS AT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1786140357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1786140357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1786140357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1786140357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1786140458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019246922.11e-125PREDICTED: uncharacterized protein LOC109226576 isoform X2
TrEMBLA0A1J6I9L81e-123A0A1J6I9L8_NICAT; Putative myb family transcription factor
STRINGXP_009802187.11e-124(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-35G2-like family protein