PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00077g05011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 296aa    MW: 33807.8 Da    PI: 5.252
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00077g05011.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.8e-1884137356
                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Peinf101Scf00077g05011.1  84 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 137
                               456899***********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1970141IPR009057Homeodomain-like
PROSITE profilePS5007117.32979139IPR001356Homeobox domain
SMARTSM003891.8E-1782143IPR001356Homeobox domain
CDDcd000861.81E-1584140No hitNo description
PfamPF000463.0E-1584137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-1986146IPR009057Homeodomain-like
PRINTSPR000311.2E-5110119IPR000047Helix-turn-helix motif
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5119135IPR000047Helix-turn-helix motif
PfamPF021834.5E-17139181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTCTSEMAFF PTNFMLQTTH EDDQHQPSTS LTPILPSCSP QDFHGIASFL GKRSMSFSGM  60
EANNCEENHG EDDLSDDGSQ AGEKKRRLNM EQVKTLEKNF ELGNKLEPER KMQLARALGL  120
QPRQIAIWFQ NRRARWKTKQ LEKDYDVLKR QFDAIKAEND ALQAQNQKLH AEIMALKNME  180
QPTESINLNK ETEGSCSNRS ENSSEIKLDI SRTPAIDSPL SNHPITSRPF FPPSMRPITN  240
GVAQLFQNSN TSSRPDLQQC LKNMDQSVKE ESLSNMFCGI DDQTAFWPWL EQQQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1425051e-149AC142505.1 Solanum demissum chromosome 5 clone PGEC287I17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548012.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-127ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLQ6L4K01e-179Q6L4K0_SOLDE; Putative DNA-binding protein
STRINGSolyc05g007180.2.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-128HD-ZIP family protein