![]() |
Plant Transcription
Factor Database
v4.0
Previous version: v1.0,
v2.0,
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00049g03026.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 106aa MW: 12182.9 Da PI: 7.5083 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 44 | 7.4e-14 | 52 | 81 | 1 | 30 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkl 30 +ep+YVNaKQy++Il+RRq Rak+ e+k Peinf101Scf00049g03026.1 52 EEPMYVNAKQYHGILRRRQLRAKAVLEQKS 81 69*********************9998884 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 0.0053 | 50 | 99 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 14.212 | 51 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 7.3E-10 | 53 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MPSMINENVT TADQFELMGQ PSIAFNSYPY SESQNVERVN HGRMILPLEV TEEPMYVNAK 60 QYHGILRRRQ LRAKAVLEQK SWKHLLPRTE TIASLCCQEL TSLSTS |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009767409.1 | 5e-32 | PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_009767410.1 | 2e-32 | PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2 | ||||
Refseq | XP_009767411.1 | 2e-32 | PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2 | ||||
Refseq | XP_009767412.1 | 2e-32 | PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2 | ||||
Refseq | XP_016441402.1 | 6e-32 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
TrEMBL | M1AEI5 | 6e-30 | M1AEI5_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400021053 | 2e-29 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA13392 | 15 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 5e-13 | nuclear factor Y, subunit A9 |