PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00049g03026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YA
Protein Properties Length: 106aa    MW: 12182.9 Da    PI: 7.5083
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00049g03026.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA447.4e-145281130
                 CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkl 30
                              +ep+YVNaKQy++Il+RRq Rak+  e+k 
  Peinf101Scf00049g03026.1 52 EEPMYVNAKQYHGILRRRQLRAKAVLEQKS 81
                              69*********************9998884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005210.00535099IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115214.21251106IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.3E-105381IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MPSMINENVT TADQFELMGQ PSIAFNSYPY SESQNVERVN HGRMILPLEV TEEPMYVNAK  60
QYHGILRRRQ LRAKAVLEQK SWKHLLPRTE TIASLCCQEL TSLSTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767409.15e-32PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_009767410.12e-32PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_009767411.12e-32PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_009767412.12e-32PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_016441402.16e-32PREDICTED: nuclear transcription factor Y subunit A-7-like
TrEMBLM1AEI56e-30M1AEI5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000210532e-29(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA133921516
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.15e-13nuclear factor Y, subunit A9