PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00047g01010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 205aa    MW: 23085.2 Da    PI: 7.7959
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00047g01010.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1972126256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ ++tkeq   Lee F++n++++ +++e LA++l+L+ rqV vWFqNrRa+ k
  Peinf101Scf00047g01010.1  72 RKKLRLTKEQSFLLEESFRQNHTLNPKQKEALAMQLKLKPRQVEVWFQNRRARSK 126
                               78889************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1855122IPR009057Homeodomain-like
SuperFamilySSF466891.75E-1963129IPR009057Homeodomain-like
PROSITE profilePS5007117.03868128IPR001356Homeobox domain
SMARTSM003897.2E-1870132IPR001356Homeobox domain
CDDcd000863.74E-1671129No hitNo description
PfamPF000466.4E-1772126IPR001356Homeobox domain
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
SMARTSM003406.4E-20128171IPR003106Leucine zipper, homeobox-associated
PfamPF021831.9E-9128161IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MPGSSTCLEL TISIPGSSSS SSFPSSGEGG GYLMRDLDIN QVPSGGKINE EESMEEEEEE  60
ESCINGIGGP PRKKLRLTKE QSFLLEESFR QNHTLNPKQK EALAMQLKLK PRQVEVWFQN  120
RRARSKLKQT EMECEYLKRW FGSLTEQNRR LKREVEELRS MKVGAPTVLS PHSCQPLPAS  180
TLSMCPHCER VTTTVARGES KINLN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120128RRARSKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045132.11e-102Homeobox-leucine zipper protein HOX3
SwissprotQ0JKX15e-82HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH385e-82HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A068TXK61e-103A0A068TXK6_COFCA; Uncharacterized protein
STRINGVIT_01s0011g04870.t014e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-62homeobox-leucine zipper protein 17