PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00039g06007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 462aa    MW: 51043.4 Da    PI: 5.2358
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00039g06007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.11.3e-06344439
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                              + C++++ +++  +C++++  lC +C    H+       H++
  Peinf101Scf00039g06007.1  3 PPCELCGVERAVVYCKSDSARLCLQCDGRVHRAnslslrHSR 44
                              68******9******************999966777777765 PP

2zf-B_box16.32e-054574332
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClle 32
                                +C+++ ++++++ C d ++++C+ C  +
  Peinf101Scf00039g06007.1 45 SLICDKCRSQPAIIRCMDEEMCMCDGCDWN 74
                              679************************865 PP

3CCT59.71e-20406449144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               R  a++RY+eK+k+R F K+irY+sRKa+A++R RvKGrFvk+ 
  Peinf101Scf00039g06007.1 406 RHIAKMRYNEKKKSRTFGKQIRYASRKARADTRRRVKGRFVKAG 449
                               66689************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.5E-9147IPR000315B-box-type zinc finger
CDDcd000211.17E-5347No hitNo description
PROSITE profilePS501199.257547IPR000315B-box-type zinc finger
PROSITE profilePS5101714.316406448IPR010402CCT domain
PfamPF062031.1E-15406448IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MDPPCELCGV ERAVVYCKSD SARLCLQCDG RVHRANSLSL RHSRSLICDK CRSQPAIIRC  60
MDEEMCMCDG CDWNGNGCIA TGHRLRKLNT YNGCPSPLEF IRVLTLVLEM PIGIDDTNFD  120
NSFGTSPCSL FMSINEDSSL ETKRNEGPLV ANKLNELPCS LLSINEDSSL ETKRNEGSLV  180
ANKLNELASN IKFEPSWAIP SNPNYLISCN RDPAPFLEGS GLSKQDCPIK DLGFQEGDLS  240
KGVDFDDVTF NFDCGYELLA GPRQNHPRYS SEDKDLDCLV MEKNSSVTGS NSHVESSIET  300
TLSSGQQEYI GLQSSQMAAA TSSMSLLQTM SATANCLLLN PTSCNRSIAG LPFLPAPIQS  360
SMSLSLSNIT GESSATTDYQ DCGLSPVFLN GESPWDFNVE NSPQKRHIAK MRYNEKKKSR  420
TFGKQIRYAS RKARADTRRR VKGRFVKAGE VYDYDPSETK DF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019246655.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 12-like isoform X1
TrEMBLA0A1J6J0L70.0A0A1J6J0L7_NICAT; Zinc finger protein constans-like 12
STRINGXP_009787133.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42311726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.13e-42B-box type zinc finger protein with CCT domain