PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00038g01014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family SBP
Protein Properties Length: 941aa    MW: 105377 Da    PI: 6.7557
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00038g01014.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.26.6e-40124200278
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                               Cqv++C +dls+ k+yhrrhkvCe+hska+ + v++++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+qa
  Peinf101Scf00038g01014.1 124 CQVDDCGVDLSKGKDYHRRHKVCEMHSKATRARVANVMQRFCQQCSRFHALEEFDEGKRSCRRRLAGHNKRRRKTQA 200
                               **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-30120185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.564121198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.15E-37122202IPR004333Transcription factor, SBP-box
PfamPF031101.8E-29124197IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MEGETQLYYR AMDLRGVGNK NIEWDPNDWK WDGHLFIAKP NNYQQSRQFF PLQTANLAVV  60
SSNTNSSSSC SDEVNLEKRE LEKRRRVVID ENDSGGGALS LKLFDGNSNN GKRSKVTSCN  120
RALCQVDDCG VDLSKGKDYH RRHKVCEMHS KATRARVANV MQRFCQQCSR FHALEEFDEG  180
KRSCRRRLAG HNKRRRKTQA DSGDNNNKTL SDGQASGYSL MSLLKILSNT HSNGTNHLED  240
QDLLSHLVRS LASQGALNGD NNLSGLLQAT SKLLNNDRSP SRNSDIVSLV SNGSRGPPRP  300
KEQHFATLAA QMPQRSSDVH DVRLDDVGTV SCQSPGTPFP IQNSSPAYAQ GRESPAGRSK  360
VINFDLNDVY VDSDDGGENL ERSPLPADRG TGSLECRSWL QQDSLQSSPP QTSRNSDSAS  420
AQSPSSSSSD AQSRTDRIVF KLFGKDPSDF PFVLRAQILD WLSHSPTEIE SYIRPGCVVL  480
TVYLRLPESA WEELCCDLSS SLSRLLDVRG DSFWRKGWIY VMLQNQIALV HDGQLLLDVP  540
LPIETIEHTS IISVKPIAVP ASDRAQFIVR GFNLTKPSTR LLCALEGDYL VAEANDEAEH  600
VDDIDKHDKL QSINLTCSIP AVSGRGFIEV EDHGLSNGFF PFIIAEDDVC SEIRMLESVI  660
ELTSADYING LTNNSELKSQ AMDFIYEMGW LLHRNNVKAR LGNSGPHAVL FPLKRFKWLM  720
EFSVDREWCA VVRKLLNLLL DGTVGTEENS FLKVSLSEMG LLHKAVRRNS RPLVELLLTY  780
TPEGIADELC SEYQSLVALE AWKNTRDSTG FTPEDYARLR GHYSYIHLVQ RKINRKASSR  840
HIVVDIPSIL SDENSNQKDE YAITSLEISQ TDRRPIRPCG LCDRKLAYGS RSRTLLYRPA  900
MFSMVALAAV CVCVALLFKS SPEVLYIFRP FRWEMLDFGS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291231971084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18286KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507693.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A2K9ZXI50.0A0A2K9ZXI5_PETHY; Squamosa promoter binding-like protein 12c
STRINGXP_009773067.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]