PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00033g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 291aa    MW: 32814.9 Da    PI: 9.0319
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00033g00013.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.63.4e-2992144356
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                               +v+Y eClkNhAa++Gg+a DGC+Efmps geegt +alkC+AC CHRnFHR+ 
  Peinf101Scf00033g00013.1  92 GVKYMECLKNHAAAIGGNARDGCCEFMPS-GEEGTLEALKCSACHCHRNFHRKL 144
                               689*************************9.999*******************96 PP

2Homeobox15.82.5e-05202257152
                               TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
                  Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                               +r Rt+ft+eq e + ++ e    k ++++ + + +  ++lg++ r+ kvW +N +
  Peinf101Scf00033g00013.1 202 KRFRTKFTREQKEKMFNFAEkagwKIQKLDDSVIHQFCQELGIKRRVLKVWMHNNK 257
                               789*********98876555777779****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2093154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-2693143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.8E-2794143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.22395144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.3E-27197263IPR009057Homeodomain-like
SuperFamilySSF466894.56E-19197262IPR009057Homeodomain-like
TIGRFAMsTIGR015651.4E-26201257IPR006455Homeodomain, ZF-HD class
CDDcd000860.00466202255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MSNISTQVVA LNNNNSNNNN NNNKSSNIDD GNYPYENGSQ AMEVHDQERV IHEEPLSEGN  60
SKKYMVMVRN SSTPFGYNKA GGNNDNIIDE GGVKYMECLK NHAAAIGGNA RDGCCEFMPS  120
GEEGTLEALK CSACHCHRNF HRKLLQGYPT GTLIITPKAA LEQRKISYKN GIITSPTSDS  180
DDGKEGAGFM ALKRPCQQAI KKRFRTKFTR EQKEKMFNFA EKAGWKIQKL DDSVIHQFCQ  240
ELGIKRRVLK VWMHNNKHNS AKKRTVCYTF YSKGLKEDAN SVNFDYYITL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-232002591675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069129.19e-71PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotO647223e-60ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLA0A151SB968e-72A0A151SB96_CAJCA; ZF-HD homeobox protein At4g24660 family
STRINGVIT_12s0035g01880.t019e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1837924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.14e-61homeobox protein 21