PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01093283G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family G2-like
Protein Properties Length: 181aa    MW: 19935.7 Da    PI: 11.3987
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01093283G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like38.62.4e-12121149230
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPk 30 
                      pr+rWt++LH+rFv+ave LGG+e+  P 
  PH01093283G0010 121 PRMRWTSTLHTRFVRAVELLGGHERESPE 149
                      9************************9986 PP

2G2-like52.61e-161491811951
          G2-like  19 eqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      e LGG+e+AtPk++le+m+vk+Ltl+hvkSHLQ
  PH01093283G0010 149 ELLGGHERATPKSVLEMMDVKDLTLAHVKSHLQ 181
                      57******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-11118181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-22119181IPR009057Homeodomain-like
PfamPF002492.2E-5122181IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.2E-11149181IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
RGIPVYSRPA AGHPFLGGGD HHHHHHPKAG LYNPYHSTAW PTSLRSTSTA TAAAPSVDPT  60
AAFLSPSAYH RMLSRTGRLH DTLRGYGTGM GTRVLGWQSF GLASSHFMPK LPASRRSMRA  120
PRMRWTSTLH TRFVRAVELL GGHERESPEL LGGHERATPK SVLEMMDVKD LTLAHVKSHL  180
Q
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01093283G0010
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0044634e-38AP004463.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0456B03.
GenBankAP0057344e-38AP005734.4 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0032E15.
GenBankAP0149644e-38AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126164e-38CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973472.19e-62probable transcription factor RL9
SwissprotQ0J2353e-38ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6RKZ83e-62A0A3L6RKZ8_PANMI; Putative transcription factor RL9
STRINGPavir.Fb00812.1.p5e-62(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-20G2-like family protein