PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01087379G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 331aa    MW: 36416.3 Da    PI: 8.3404
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01087379G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.5e-2569112144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  PH01087379G0010  69 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 112
                      79***************************************998 PP

2QLQ48.82.1e-17132637
              QLQ  6 aQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +Q+q+L++Q+l+yKy+a++ P+P++L++++++
  PH01087379G0010  1 SQWQELEHQALIYKYMASGTPIPSDLILPLRR 32
                     6****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF088805.2E-12130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.1132IPR014978Glutamine-Leucine-Glutamine, QLQ
SMARTSM009512.2E-4132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57369113IPR014977WRC domain
PfamPF088791.7E-2070112IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
SQWQELEHQA LIYKYMASGT PIPSDLILPL RRSFLLDSAL ATSPSLAFPP QPSLGWGYFS  60
MGFGRKTEDP EPGRCRRTDG KKWRCSKEAY PDSKYCEKHM HRGKNRSRKP VEMSLATPPP  120
SSSASSSSNA SAVNAATTTS SPAPSYHRPA AAAHDVTPYH ALYGGPYAAS ARPPGAGAFH  180
AQVSPFHLHL DTTHPHPPPS YYSMDHKDYA YGHSAKEVHG EHAFFSDSTE RDHHAGHGQW  240
QFKQLGMEPK QSATSFFPGG GYGNSAASPY PIDLSKEEDE EKERRQQQHC FVLGADLRLE  300
KPAGHDAAAG AAQKPLRHFF NEWPHEKGSK G
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01087379G0010
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2018950.0AF201895.1 Oryza sativa growth-regulating factor 1 (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647996.10.0PREDICTED: growth-regulating factor 1
SwissprotQ6AWY81e-177GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLJ3LHM01e-179J3LHM0_ORYBR; Uncharacterized protein
STRINGOB02G41370.11e-180(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-48growth-regulating factor 5