PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01007654G0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 321aa    MW: 35199 Da    PI: 8.8728
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01007654G0010genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP476.7e-15731064578
                      TTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  45 qCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +fh+lsefD++krsCrrrL++hn+rrrk+q+
  PH01007654G0010  73 LFVQFHALSEFDQKKRSCRRRLSHHNARRRKPQP 106
                      5568***************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114112.80218104IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-1253110IPR004333Transcription factor, SBP-box
PfamPF031107.9E-775103IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSAMILKSIG DKGSPCRKPF LVWKKCPTSL LTLTATLPPE TKDSTQEIHL GEKPFIRKDS  60
VCVYDCVSRK VVLFVQFHAL SEFDQKKRSC RRRLSHHNAR RRKPQPDVFS FGSAVLPSSL  120
FGNVFVSYKD DRGLISFVWN EAPLSHVKPL SYSSRSRPSD FKLSQVLDIG ERSTKVGAVN  180
GQIDLSESNL SDVFPTLCHN IDELLPIKGA DACGAASKLD GAPDLRRALS LLSASSWGST  240
DPAQQASSLI QFTDANQNGK MSSVSNGGNS NSPFWINGQP LAPESQVVQF TMDTGSTVFQ  300
DLERIKPAYE SALFSMNQIH *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
185102KKRSCRRRLSHHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01007654G0010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0945090.0FP094509.1 Phyllostachys edulis cDNA clone: bphyst033c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657223.11e-95PREDICTED: squamosa promoter-binding-like protein 11
SwissprotQ653Z53e-95SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLA0A0D9WSY21e-100A0A0D9WSY2_9ORYZ; Uncharacterized protein
STRINGLPERR06G19770.31e-101(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952