PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005978G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 727aa    MW: 80385.8 Da    PI: 5.6503
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005978G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS337.72e-1033457171373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l+ lL++cA+av++gd + a++lL+++++++sp+gd++qRla++f+e+L+arla+++s++y++l +++ts   ++++l+a+kl+  ++ + k+ 
  PH01005978G0070 345 LRALLIHCAQAVATGDRRSANELLKQIKQHSSPRGDATQRLAHCFAEGLEARLAGMGSQVYQSLMAKRTS---VVDNLKAYKLYMAACCFRKVN 435
                      5789************************************************************999999...********************* PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      +    ++I++av+g +r+Hi+D+++++G+Q+p Llq La+R++gpp++R Tg++ p++g   + ++eetg+rL+++A+elgv+f+f++ +a ++
  PH01005978G0070 436 FAFSVKTIYNAVAGRSRLHIVDYGVQYGFQFPGLLQWLAAREGGPPEVRFTGIDLPQPGfrPAFQIEETGRRLSNYARELGVSFKFHA-IAAKW 528
                      **********************************************************999***************************.799** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                      e+++ e+L+++p+E+l+Vn++    +l+desv ++s  +rd vL+ +++++P+v++    +  ++++ Fl+rf eal +ysa fd l+a++pre
  PH01005978G0070 529 ETIRGEDLNIDPDEVLVVNSQCDFAKLMDESVVTDSpsPRDVVLSNIRKMRPDVFIQFVLNGTYGAPFFLTRFREALFFYSAHFDVLDATIPRE 622
                      *******************************99988779******************************************************* PP

             GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       ++r  +Er +lg+ + nv+acega+r+   et+++W+ r ++aG++++pl+ ++++ ++  +++++ + + v+ ++ +l++gWk+r L+++S 
  PH01005978G0070 623 CDDRLLIERDILGPYALNVIACEGADRVDCPETYKQWQVRNHRAGLRQLPLNPEVVQFVRDKVKNHYHKDFVVDVDHRWLLQGWKGRVLYTMST 716
                      *******************************************************************888************************ PP

             GRAS 373 W 373
                      W
  PH01005978G0070 717 W 717
                      * PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.049319698IPR005202Transcription factor GRAS
PfamPF035147.0E-101345717IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MATTPEEFLR EGFLVDPEPF SPSPFLDLPP TPHGHADAVE DPASSDDLIL PYISRMLMEE  60
DIDDKFFYQY PDHPALLTSQ QRYAQILSSS SSHSATNSGN STALSPSSSS PDAPASANPT  120
SPYDPIELSQ LLQSPPFPDV GLGLADDVDN LFLPGDVAPS AGFQQSPPLY DVDNSYFAGA  180
GQNGSGTGIQ SSAFLNGTDE EAKTIITLPA GDGDQGALAS AFFNGQTDGN IHMLNLAFLK  240
GMEEAKKFLP TNNTLLTARA WRRPRRAART GTTGSGRNSK MMMPEQEENG AREMFDEIMV  300
RGHEIIMKGM EDLRIAMGSE AEKKSRKGTG KAARGSRGAI VVVDLRALLI HCAQAVATGD  360
RRSANELLKQ IKQHSSPRGD ATQRLAHCFA EGLEARLAGM GSQVYQSLMA KRTSVVDNLK  420
AYKLYMAACC FRKVNFAFSV KTIYNAVAGR SRLHIVDYGV QYGFQFPGLL QWLAAREGGP  480
PEVRFTGIDL PQPGFRPAFQ IEETGRRLSN YARELGVSFK FHAIAAKWET IRGEDLNIDP  540
DEVLVVNSQC DFAKLMDESV VTDSPSPRDV VLSNIRKMRP DVFIQFVLNG TYGAPFFLTR  600
FREALFFYSA HFDVLDATIP RECDDRLLIE RDILGPYALN VIACEGADRV DCPETYKQWQ  660
VRNHRAGLRQ LPLNPEVVQF VRDKVKNHYH KDFVVDVDHR WLLQGWKGRV LYTMSTWVAE  720
DTNSIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-363497178374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1HSE90.0I1HSE9_BRADI; Uncharacterized protein
STRINGBRADI2G52227.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-142GRAS family protein