PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005720G0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 221aa    MW: 24500.8 Da    PI: 6.2257
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005720G0030genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.12.6e-1070119150
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      e+el++ r+   NReA r++R++Kka ++ Lee++k+L a N++L  +l+
  PH01005720G0030  70 EEELRKPRKPLGNREAVRKYREKKKAHTAFLEEEIKKLRATNQQLVRRLQ 119
                      78999****************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-1470138No hitNo description
SMARTSM003383.1E-1170137IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.80672119IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.44E-873120No hitNo description
PfamPF077164.6E-1274127IPR004827Basic-leucine zipper domain
CDDcd146861.85E-1177128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MDDGLDLPIP SHLLFSHPEI SHGFDEFLKN TTTCTHTHTC NPPGPTVAMH THTCLHTHTQ  60
AIASGENNVE EELRKPRKPL GNREAVRKYR EKKKAHTAFL EEEIKKLRAT NQQLVRRLQG  120
HAALEAEVVR LRSILFDVRG KIDPEIGSFP FQKLCSVGSV ICTDHTLFFN TNTEVAVREE  180
ISIPTVVDCG IDESGIISQE LDIPEMANSM DAVASFVNPA *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618027.11e-124PREDICTED: uncharacterized protein LOC107278258
RefseqXP_015618034.11e-124PREDICTED: uncharacterized protein LOC107278258
SwissprotQ8GTS24e-51BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0P0V9D31e-124A0A0P0V9D3_ORYSJ; Os01g0801901 protein
STRINGOB01G42980.11e-119(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.13e-40bZIP family protein