PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005711G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family Whirly
Protein Properties Length: 307aa    MW: 35266.4 Da    PI: 9.7248
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005711G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly156.48.9e-499020423137
           Whirly  23 sgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslv 116
                       ++ ++ ++G++ll++a+a+++ +ydW +kq+f+ls+ e+++l+ l++ +sc+ffhdp+++ s+eGkvrk+lkveP pdG G f+nlsv+n l+
  PH01005711G0070  90 QEAYRVAKDGFVLLQFAPAVSPHQYDWTRKQVFSLSVWEMGSLLTLGPIDSCKFFHDPFKGRSDEGKVRKVLKVEPTPDGNGCFFNLSVQNRLL 183
                      57899***************************************************************************************** PP

           Whirly 117 kgnesfsvPvskaefavlrsl 137
                      + +e +++P++k+efav++  
  PH01005711G0070 184 NIDEIIYIPITKGEFAVIIPY 204
                      *****************9865 PP

2Whirly68.21.5e-2121026880138
           Whirly  80 paakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                       + ++s+eGkvrk+lkveP pdG G f+nlsv+n l++ +es+++P++k+efav+ s +
  PH01005711G0070 210 FGFRESDEGKVRKVLKVEPTPDGNGRFFNLSVQNRLLNIDESIYIPITKGEFAVVVSTF 268
                      55689*************************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.1E-4890207IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.1E-4491207IPR009044ssDNA-binding transcriptional regulator
PfamPF085369.8E-4791201IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.106.7E-29208290IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.7E-16212266IPR013742Plant transcription factor
SuperFamilySSF544474.63E-33212306IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSKLFLSYPL YNPNSKAITM AEARRFLAPS VLWCDWARGR RHPLVVWIWS VFQSSSRFGV  60
VGSDANLRVS PHNHRHGLEG KNSPLMLHLQ EAYRVAKDGF VLLQFAPAVS PHQYDWTRKQ  120
VFSLSVWEMG SLLTLGPIDS CKFFHDPFKG RSDEGKVRKV LKVEPTPDGN GCFFNLSVQN  180
RLLNIDEIIY IPITKGEFAV IIPYFTFREF GFRESDEGKV RKVLKVEPTP DGNGRFFNLS  240
VQNRLLNIDE SIYIPITKGE FAVVVSTFNY IIPHLMGWST FTNSIKPEDS WAYRRPQSGP  300
EYEWRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koq_A1e-569228638169Single-stranded DNA-binding protein WHY3, chloroplastic
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPH01005711G0070
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8361941e-97CT836194.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA048P18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557198.12e-65single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotB2LXS74e-65WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A1D6LKY33e-82A0A1D6LKY3_MAIZE; Whirly1
STRINGTRIUR3_12734-P16e-65(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.26e-58ssDNA-binding transcriptional regulator
Publications ? help Back to Top
  1. Soderlund C, et al.
    Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs.
    PLoS Genet., 2009. 5(11): p. e1000740
    [PMID:19936069]