PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01005526G0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRAS
Protein Properties Length: 641aa    MW: 71718.2 Da    PI: 6.3604
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01005526G0030genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3596.9e-1102606311373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a+p+gd++qRla++f+e+L+arla+++s + ++l +++ts    ++ l+a++l+  +  + k+ 
  PH01005526G0030 260 LRTLLIHCAQAVATDDRRSATELLKQIKQHANPQGDATQRLAHCFAEGLQARLAGTGSLVHQSLMAKRTS---AVDILQAYQLYMAAICFKKVF 350
                      6789***************************************************999999999998888...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  N++I +   g++++Hi+D++i +G+QWp++l+ +a+R++gpp++RiTg++ p++g   +e++eetg+rL+++A+e+gvpf++++++a ++
  PH01005526G0030 351 FIFSNHTIFNVSLGKKKIHIVDYGIHYGFQWPCFLRRIADREGGPPEVRITGIDIPQPGfrPTERIEETGRRLSNYAREFGVPFKYHAIAAAKM 444
                      **********************************************************9******************************999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l+Vn+ +q ++l+desv ++s+rd vL+ +++++P+ ++++  + +++++ F++rf eal y+sa+fd l+++ pr++e
  PH01005526G0030 445 ESVRKEDLNIDPDEVLIVNCLYQFKNLMDESVVIDSPRDIVLNNIRKMRPHAFIHAIVNGSYSAPFFVTRFREALFYFSAMFDILDTTTPRNNE 538
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      +r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ ++++ a+  ++k++ + + ++ ++++l++gWk+r L+++S W
  PH01005526G0030 539 QRMLIEQNIFGRSALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNPDIVQVAREKVKKCYHKDFVIDVDHQWLLQGWKGRILFAISTW 631
                      *****************************************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.354234612IPR005202Transcription factor GRAS
PfamPF035142.4E-107260631IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MEENIDDKFF YDYPDHPALL QAQQPFLDIL SDPSSQSNSS DSNNNHLSPS SSDASVSTAA  60
ALRTSAAVNS YDPLQYTSID LDPAAFFGGG VNSDLMSSAF LKGMEEANKF LPSEDKLVID  120
LEASSGEFLK GVEEANKFLP SEDKLLVGFN GVSAPAVVAS VKKEEAVDAV VAGRGRKNPY  180
DDEELELEGG RSSKQTAVQG DDVAARDMFD KVMMTSHEMC VQQMKNLRIA MQEEAAKNEA  240
DSGGNRKARG RRGGKDVVDL RTLLIHCAQA VATDDRRSAT ELLKQIKQHA NPQGDATQRL  300
AHCFAEGLQA RLAGTGSLVH QSLMAKRTSA VDILQAYQLY MAAICFKKVF FIFSNHTIFN  360
VSLGKKKIHI VDYGIHYGFQ WPCFLRRIAD REGGPPEVRI TGIDIPQPGF RPTERIEETG  420
RRLSNYAREF GVPFKYHAIA AAKMESVRKE DLNIDPDEVL IVNCLYQFKN LMDESVVIDS  480
PRDIVLNNIR KMRPHAFIHA IVNGSYSAPF FVTRFREALF YFSAMFDILD TTTPRNNEQR  540
MLIEQNIFGR SALNVIACEG TDRVERPETY KQWQVRNQRA GLKQLPLNPD IVQVAREKVK  600
KCYHKDFVID VDHQWLLQGW KGRILFAIST WVANDTSSYF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-432646318374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-173SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0E0FDC60.0A0A0E0FDC6_9ORYZ; Uncharacterized protein
STRINGBRADI4G03867.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-170GRAS family protein